3VUL: Cysteine-deficient mutant M1 in MAP kinase JNK1

Crystal structure of a cysteine-deficient mutant M1 in MAP kinase JNK1. Determined by X-ray diffraction at 2.81 Å resolution. Released 13 Feb 2013.

Method: X-ray diffraction
Resolution: 2.81 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,896
Mol. weight: 43.99 kDa
Released: 13 Feb 2013

Explore 3VUL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VUL contains 20 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	18-23	6	1
β-strand	26-34	9	2
β-strand	39-45	7	2
β-strand	50-57	8	2
α-helix	64-79	16
β-strand	82	1	3
β-strand	85	1	3
β-strand	88-92	5	2
β-strand	104-109	6	2
β-strand	113-114	2	3
α-helix	125-144	20
α-helix	154-156	3
β-strand	157-159	3	3
β-strand	165-167	3	3
α-helix	194-197	4
α-helix	206-220	15
α-helix	232-241	10
α-helix	243-245	3
α-helix	246-249	4
α-helix	254-262	9
α-helix	271-274	4
α-helix	277-279	3
α-helix	282-284	3
α-helix	291-301	11
α-helix	306-308	3
α-helix	312-317	6
α-helix	322-324	3
α-helix	327-330	4
α-helix	332-335	4
α-helix	349-362	14

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	555-557	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitogen-activated protein kinase 8	A	protein	370	Homo sapiens	P45983 (AlphaFold model)
Peptide from C-Jun-amino-terminal kinase-interacting protein 1	F	protein	11	Homo sapiens	Q9UQF2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VUL_1 Mitogen-activated protein kinase 8 (chains A)
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKVVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLSQVIQ
MELDHERMSYLLYQMLVGIKHLHSAGIIHRDLKPSNIVVKSDATLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGVIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPSPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEHHHHHH

Sequence of entity 2 (F), FASTA

>3VUL_2 Peptide from C-Jun-amino-terminal kinase-interacting protein 1 (chains F)
RPKRPTTLNLF

Primary citation

Seven cysteine-deficient mutants depict the interplay between thermal and chemical stabilities of individual cysteine residues in mitogen-activated protein kinase c-Jun N-terminal kinase 1. Nakaniwa, T., Fukada, H., Inoue, T. et al. Biochemistry (2012) 51:8410-8421. DOI 10.1021/bi300918w · PubMed

Other PDB entries of the same protein (UniProt P45983 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XRW 1.33 Å, Linear binding motifs for JNK and for calcineurin antagonistically control the nuclear…
12CV 1.5 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-2728
4QTD 1.5 Å, Structure of human JNK1 in complex with SCH772984 and the AMPPNP-hydrolysed triphosphate…
11ZL 1.55 Å, Crystal Structure of human JNK1 Kinase Domain in complex with inhibitor CCD-3013
8R5E 1.7 Å, JNK1 covalently bound to RU77 cyclohexenone based inhibitor
3ELJ 1.8 Å, Jnk1 complexed with a bis-anilino-pyrrolopyrimidine inhibitor.
4AWI 1.91 Å, Human Jnk1alpha kinase with 4-phenyl-7-azaindole IKK2 inhibitor.
4L7F 1.95 Å, Co-crystal Structure of JNK1 and AX13587
3PZE 2.0 Å, JNK1 in complex with inhibitor
8X5M 2.0 Å, The Crystal Structure of JNK1 from Biortus.
4HYU 2.15 Å, Crystal structure of JNK1 in complex with JIP1 peptide and…
4E73 2.27 Å, Crystal structure of JNK1beta-JIP in complex with an azaquinolone inhbitor

Browse structure collections

About this viewer

MolViewer shows 3VUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.