3W3D: Smooth muscle G actin DNase I complex

Crystal structure of smooth muscle G actin DNase I complex. Determined by X-ray diffraction at 1.8 Å resolution. Released 30 Jan 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Gallus gallus, Bos taurus
Chains: 2
Atoms: 5,472
Mol. weight: 72.65 kDa
Ligands: ATP, CA
Released: 30 Jan 2013

Explore 3W3D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W3D contains 39 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	2-6	5
β-strand	7-11	5	1
β-strand	15-20	6	1
β-strand	28-31	4	1
β-strand	34-37	4	2
β-strand	41-43	3	3
α-helix	47-49	3
β-strand	52-53	2	2
α-helix	55-59	5
α-helix	61-63	3
β-strand	64-67	4	2
β-strand	70-71	2	4
β-strand	74-75	2	4
α-helix	78-86	9
α-helix	87-93	7
α-helix	97-99	3
α-helix	101	1
β-strand	102-106	5	1
α-helix	112-120	9
α-helix	121-126	6
β-strand	130-135	6	1
α-helix	136-143	8
β-strand	149-154	6	5
β-strand	159-165	7	5
β-strand	168-169	2	5
α-helix	171-173	3
β-strand	175-177	3	5
α-helix	181-194	14
α-helix	202-215	14
α-helix	222-231	10
β-strand	237-240	4	6
β-strand	246-249	4	6
α-helix	252-258	7
α-helix	263-266	4
α-helix	273-283	11
α-helix	288-293	6
β-strand	296-299	4	5
α-helix	302-304	3
α-helix	308-317	10
β-strand	328-329	2	5
α-helix	337-347	11
α-helix	350-353	4
α-helix	355	1
β-strand	356-357	2	1
α-helix	358-362	5

Chain B: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	3
α-helix	13-17	5
α-helix	19-29	11
β-strand	34-40	7	3
α-helix	46-56	11
β-strand	64-67	4	3
β-strand	71	1	7
β-strand	78	1	7
β-strand	79-84	6	3
β-strand	89-96	8	8
β-strand	99	1	9
β-strand	101	1	9
α-helix	103-107	5
α-helix	112-113	2
β-strand	114-120	7	8
β-strand	127-134	8	8
α-helix	137-139	3
α-helix	140-158	19
β-strand	163-168	6	8
α-helix	173-175	3
α-helix	178-181	4
α-helix	185-188	4
β-strand	192-194	3	8
β-strand	203	1	10
β-strand	212-217	6	8
α-helix	219-224	6
β-strand	225	1	11
α-helix	226	1
β-strand	231-232	2	3
α-helix	235-238	4
α-helix	243-249	7
β-strand	252	1	10
β-strand	255-258	4	3
β-strand	259	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, gamma-enteric smooth muscle	A	protein	374	Gallus gallus	P63270 (AlphaFold model)
Deoxyribonuclease-1	B	protein	260	Bos taurus	P00639 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3W3D_1 Actin, gamma-enteric smooth muscle (chains A)
EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
RGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQ
IMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLA
GRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYE
LPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSG
GTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQE
YDEAGPSIVHRKCF

Sequence of entity 2 (B), FASTA

>3W3D_2 Deoxyribonuclease-1 (chains B)
LKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDP
NTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSS
HSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQ
WSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYG
LSNEMALAISDHYPVEVTLT

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
CA	Calcium ion	Ca	2

Primary citation

Refined structure and solvent network of chicken gizzard G-actin DNase 1 complex at 1.8A resolution. Sasaki, K., Sakabe, K., Sakabe, N. et al. Acta Crystallogr A (1993) 49:C111-C112.

Browse structure collections

About this viewer

MolViewer shows 3W3D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.