Crystal Structure of Keap1 in Complex with phosphorylated p62. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Sept 2013.
Explore 3WDZ in 3D Show helices and sheets RCSB PDB PDBe
3WDZ contains 5 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 328-331 | 4 | 1 |
| β-strand | 334 | 1 | 2 |
| β-strand | 338 | 1 | 2 |
| β-strand | 342-345 | 4 | 1 |
| β-strand | 352-354 | 3 | 1 |
| α-helix | 356-358 | 3 | |
| β-strand | 363 | 1 | 3 |
| β-strand | 366-370 | 5 | 4 |
| β-strand | 373-377 | 5 | 4 |
| β-strand | 380-383 | 4 | 3 |
| β-strand | 386-389 | 4 | 3 |
| β-strand | 393-397 | 5 | 4 |
| β-strand | 402-406 | 5 | 4 |
| α-helix | 407-409 | 3 | |
| β-strand | 414-421 | 8 | 5 |
| β-strand | 424-432 | 9 | 5 |
| β-strand | 435-436 | 2 | 5 |
| β-strand | 440-444 | 5 | 5 |
| α-helix | 445-447 | 3 | |
| β-strand | 449-452 | 4 | 5 |
| α-helix | 454-456 | 3 | |
| β-strand | 461 | 1 | 6 |
| β-strand | 464-468 | 5 | 6 |
| β-strand | 471-478 | 8 | 6 |
| β-strand | 483-491 | 9 | 6 |
| β-strand | 496-500 | 5 | 6 |
| β-strand | 508 | 1 | 7 |
| β-strand | 511-515 | 5 | 8 |
| β-strand | 518-522 | 5 | 8 |
| β-strand | 525 | 1 | 7 |
| β-strand | 530 | 1 | 7 |
| β-strand | 534-538 | 5 | 8 |
| β-strand | 544-547 | 4 | 8 |
| α-helix | 548-550 | 3 | |
| β-strand | 555 | 1 | 9 |
| β-strand | 558-561 | 4 | 10 |
| β-strand | 566-569 | 4 | 10 |
| β-strand | 572 | 1 | 9 |
| β-strand | 577 | 1 | 9 |
| β-strand | 580-585 | 6 | 10 |
| β-strand | 590-596 | 7 | 10 |
| β-strand | 602 | 1 | 2 |
| β-strand | 605-608 | 4 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 348 | 1 | 11 |
| β-strand | 355 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kelch-like ECH-associated protein 1 | A | protein | 311 | Mus musculus | Q9Z2X8 (AlphaFold model) |
| Peptide from Sequestosome-1 | B | protein | 14 | Mus musculus | Q64337 (AlphaFold model) |
>3WDZ_1 Kelch-like ECH-associated protein 1 (chains A) MGHHHHHHDYDIPTTENLYFQGAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADL QVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGV GVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF DGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD VETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMT SGRSGVGVAVT
>3WDZ_2 Peptide from Sequestosome-1 (chains B) KEVDPSTGELQSLQ
Phosphorylation of p62 activates the Keap1-Nrf2 pathway during selective autophagy. Ichimura, Y., Waguri, S., Sou, Y.S. et al. Mol Cell (2013) 51:618-631. DOI 10.1016/j.molcel.2013.08.003 · PubMed
Other PDB entries of the same protein (UniProt Q9Z2X8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.