3WEE: Full-length yeast Arp7-Arp9 Heterodimer

Structure of the full-length yeast Arp7-Arp9 Heterodimer. Determined by X-ray diffraction at 3.1 Å resolution. Released 26 Feb 2014.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 6,763
Mol. weight: 111.01 kDa
Ligands: CXS, MMC
Released: 26 Feb 2014

Explore 3WEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WEE contains 45 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	1
β-strand	18-23	6	1
β-strand	35-38	4	1
β-strand	41-45	5	2
β-strand	51-54	4	2
β-strand	63-65	3	2
β-strand	68-69	2	3
β-strand	72-73	2	3
α-helix	76-91	16
β-strand	111-115	5	1
α-helix	121-133	13
β-strand	139-144	6	1
α-helix	145-152	8
β-strand	159-164	6	4
β-strand	169-175	7	4
β-strand	178-179	2	4
β-strand	185-187	3	4
α-helix	191-201	11
α-helix	207-214	8
β-strand	220	1	5
α-helix	221-223	3
α-helix	224-228	5
β-strand	251-254	4	6
β-strand	282-285	4	6
β-strand	290-294	5	6
α-helix	296-299	4
α-helix	303-318	16
α-helix	323-331	9
β-strand	333-336	4	4
α-helix	338-341	4
β-strand	343	1	5
α-helix	345-357	13
α-helix	363-374	12
α-helix	379-386	8
α-helix	389-390	2
α-helix	396-399	4
β-strand	400	1	7
β-strand	409	1	4
α-helix	410-412	3
α-helix	424-440	17
β-strand	449-450	2	1
α-helix	451-457	7
α-helix	458-464	7

Chain B: 25 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	8
β-strand	16-21	6	8
β-strand	29-32	4	8
β-strand	35-39	5	9
β-strand	45-48	4	9
α-helix	51-60	10
β-strand	65-68	4	9
β-strand	71	1	10
β-strand	77	1	10
α-helix	80-89	10
α-helix	90-94	5
β-strand	104-108	5	8
α-helix	115-116	2
α-helix	117-124	8
α-helix	125-130	6
β-strand	136-140	5	8
α-helix	141-148	8
β-strand	154-159	6	11
β-strand	164-169	6	11
β-strand	170	1	12
β-strand	173	1	12
α-helix	176-178	3
β-strand	180-181	2	11
α-helix	186-202	17
α-helix	216-225	10
α-helix	227-235	9
α-helix	243-256	14
α-helix	283-285	3
β-strand	287-292	6	7
β-strand	297-302	6	7
α-helix	303-314	12
α-helix	316-318	3
α-helix	325-327	3
α-helix	329-343	15
α-helix	344-347	4
α-helix	381-390	10
β-strand	392-395	4	11
α-helix	397-400	4
α-helix	404-415	12
β-strand	423-425	3	11
α-helix	429-433	5
α-helix	435-444	10
α-helix	451-454	4
α-helix	457-467	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-like protein ARP9	A	protein	476	Saccharomyces cerevisiae	Q05123 (AlphaFold model)
Actin-related protein 7	B	protein	485	Saccharomyces cerevisiae	Q12406 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3WEE_1 Actin-like protein ARP9 (chains A)
MDYKDDDDKGAPFRQDSILIIYPRSQTTLVQFGLNEETFTVPELEIPTQIYRTTRQDGSY
TYHSTNKDNKAELIKPIQNGEIIDISAFTQFLRLIFVSILSDRANKNQDAFEAELSNIPL
LLITHHSWSQSDLEIITQYVFESLEINNLIQLPASLAATYSMISLQNCCIIDVGTHHTDI
IPIVDYAQLDHLVSSIPMGGQSINDSLKKLLPQWDDDQIESLKKSPIFEVLSDDAKKLSS
FDFGNENEDEDEGTLNVAEIITSGRDTREVLEERERGQKVKNVKNSDLEFNTFWDEKGNE
IKVGKQRFQGCNNLIKNISNRVGLTLDNIDDINKAKAVWENIIIVGGTTSISGFKEALLG
QLLKDHLIIEPEEEKSKREEEAKSVLPAATKKKSKFMTNSTAFVPTIEYVQCPTVIKLAK
YPDYFPEWKKSGYSEIIFLGAQIVSKQIFTHPKDTFYITREKYNMKGPAALWDVQF

Sequence of entity 2 (B), FASTA

>3WEE_2 Actin-related protein 7 (chains B)
MTLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAE
KRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAIL
ERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVV
RSKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSE
KDLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLT
LDLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGT
SHINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYK
LTTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRDRKQSQATNATNPHH
HHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CXS	3-cyclohexyl-1-propylsulfonic acid	C9 H19 N O3 S	1
MMC	Methyl mercury ion	C H3 Hg	6

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of the full-length yeast Arp7-Arp9 heterodimer. Lobsiger, J., Hunziker, Y., Richmond, T.J. Acta Crystallogr D Biol Crystallogr (2014) 70:310-316. DOI 10.1107/S1399004713027417 · PubMed

Other PDB entries of the same protein (UniProt Q05123 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I6M 2.8 Å, Structure of Arp7-Arp9-Snf2(HSA)-RTT102 subcomplex of SWI/SNF chromatin remodeler.
7C4J 2.89 Å, Cryo-EM structure of the yeast Swi/Snf complex in a nucleosome free state
5TGC 3.25 Å, Structure of the hetero-trimer of Rtt102-Arp7/9 bound to ATP
6VZ4 3.9 Å, Cryo-EM structure of Sth1-Arp7-Arp9-Rtt102 bound to the nucleosome in ADP Beryllium…
9PB3 4.0 Å, ARP of SWI/SNF of PIC-Med-SWI/SNF
6VZG 4.2 Å, Cryo-EM structure of Sth1-Arp7-Arp9-Rtt102
7EGP 6.9 Å, The structure of SWI/SNF-nucleosome complex
6KW3 7.13 Å, The ClassA RSC-Nucleosome Complex
6KW4 7.55 Å, The ClassB RSC-Nucleosome Complex
6UXW 8.96 Å, SWI/SNF nucleosome complex with ADP-BeFx
6KW5 10.13 Å, The ClassC RSC-Nucleosome Complex
6TDA 15.0 Å, Structure of SWI/SNF chromatin remodeler RSC bound to a nucleosome

Browse structure collections

About this viewer

MolViewer shows 3WEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.