3WN7: Keap1

Name: PDB 3WN7: Crystal Structure of Keap1 in Complex with the N-terminal region of the Nrf2 transcription factor
Published: 2013-12-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of Keap1 in Complex with the N-terminal region of the Nrf2 transcription factor. Determined by X-ray diffraction at 1.57 Å resolution. Released 25 Dec 2013.

Method: X-ray diffraction
Resolution: 1.57 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,518
Mol. weight: 77.33 kDa
Released: 25 Dec 2013

Explore 3WN7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3WN7 contains 18 α-helices and 80 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	328-331	4	1
β-strand	334-335	2	2
β-strand	337-338	2	2
β-strand	342-346	5	1
β-strand	351-354	4	1
α-helix	356-358	3
β-strand	363	1	3
β-strand	366-370	5	4
β-strand	373-377	5	4
β-strand	380-383	4	3
β-strand	386-389	4	3
β-strand	393-397	5	4
β-strand	402-405	4	4
α-helix	407-409	3
β-strand	414	1	5
β-strand	417-421	5	6
β-strand	424-428	5	6
β-strand	431-432	2	5
β-strand	435-436	2	5
β-strand	440-444	5	6
β-strand	449-453	5	6
α-helix	454-456	3
β-strand	461	1	7
β-strand	464-468	5	7
β-strand	471-478	8	7
β-strand	483-491	9	7
β-strand	496-499	4	7
α-helix	501-503	3
β-strand	508	1	8
β-strand	511-515	5	9
β-strand	518-522	5	9
β-strand	525	1	8
β-strand	530	1	8
β-strand	534-538	5	9
β-strand	543-546	4	9
α-helix	548-550	3
β-strand	555	1	10
β-strand	558-562	5	11
β-strand	565-569	5	11
β-strand	572	1	10
β-strand	577	1	10
β-strand	581-585	5	11
β-strand	590-593	4	11
α-helix	595-597	3
β-strand	602	1	2
β-strand	605-608	4	1

Chains B and M: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	19-25	7
α-helix	28-30	3
α-helix	34-37	4

Chain L: 6 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	328-331	4	12
β-strand	334-335	2	13
β-strand	337-338	2	13
β-strand	342-346	5	12
β-strand	351-354	4	12
α-helix	356-358	3
β-strand	363	1	14
β-strand	366-370	5	15
β-strand	373-377	5	15
β-strand	380-383	4	14
β-strand	386-389	4	14
β-strand	393-397	5	15
β-strand	402-405	4	15
α-helix	407-409	3
β-strand	414	1	16
β-strand	417-421	5	17
β-strand	424-428	5	17
β-strand	431-432	2	16
β-strand	435-436	2	16
β-strand	440-444	5	17
β-strand	449-453	5	17
α-helix	454-456	3
β-strand	461	1	18
β-strand	464-468	5	18
β-strand	471-478	8	18
β-strand	483-491	9	18
β-strand	496-499	4	18
α-helix	501-503	3
β-strand	508	1	19
β-strand	511-515	5	20
β-strand	518-522	5	20
β-strand	525	1	19
β-strand	530	1	19
β-strand	534-538	5	20
β-strand	543-547	5	20
α-helix	548-550	3
β-strand	555	1	21
β-strand	558-562	5	22
β-strand	565-569	5	22
β-strand	572	1	21
β-strand	577	1	21
β-strand	581-585	5	22
β-strand	590-593	4	22
α-helix	595-597	3
β-strand	602	1	13
β-strand	605-608	4	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like ECH-associated protein 1	A, L	protein	311	Mus musculus	Q9Z2X8 (AlphaFold model)
Peptide from Nuclear factor erythroid 2-related factor 2	B, M	protein	35	Mus musculus	Q60795 (AlphaFold model)

Sequence of entity 1 (A, L), FASTA

>3WN7_1 Kelch-like ECH-associated protein 1 (chains A, L)
MGHHHHHHDYDIPTTENLYFQGAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADL
QVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGV
GVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF
DGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYD
VETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMT
SGRSGVGVAVT

Sequence of entity 2 (B, M), FASTA

>3WN7_2 Peptide from Nuclear factor erythroid 2-related factor 2 (chains B, M)
MDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQ

Primary citation

Kinetic, thermodynamic, and structural characterizations of the association between Nrf2-DLGex degron and Keap1. Fukutomi, T., Takagi, K., Mizushima, T. et al. Mol Cell Biol (2014) 34:832-846. DOI 10.1128/MCB.01191-13 · PubMed

Other PDB entries of the same protein (UniProt Q9Z2X8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HWQ 1.14 Å, Crystal structure of the Keap1 Kelch domain in complex with the XChem fragment Z19735904…
7OFE 1.19 Å, Keap1 kelch domain bound to a small molecule inhibitor of the Keap1-Nrf2 protein-protein…
9F2Q 1.2 Å, Crystal structure of Keap1 kelch domain in complex with a tetrahydroisoquinoline-based…
6ZF4 1.21 Å, Keap1 kelch domain bound to a small molecule inhibitor of the Keap1-Nrf2 protein-protein…
7OFD 1.25 Å, Keap1 kelch domain bound to a small molecule fragment
6ZF3 1.28 Å, Keap1 kelch domain bound to a small molecule inhibitor of the Keap1-Nrf2 protein-protein…
6ZF5 1.29 Å, Keap1 kelch domain bound to a small molecule inhibitor of the Keap1-Nrf2 protein-protein…
8A46 1.32 Å, Crystal structure of the human Kelch domain of Keap1 in complex with compound S217879
8Q1R 1.33 Å, mouse Keap1 in complex with stapled peptide
9F2P 1.36 Å, Crystal structure of Keap1 kelch domain in complex with a fluorenone-based small…
6ZF7 1.37 Å, Keap1 kelch domain bound to a small molecule inhibitor of the Keap1-Nrf2 protein-protein…
7OFF 1.37 Å, Keap1 kelch domain bound to a small molecule inhibitor of the Keap1-Nrf2 protein-protein…

Browse structure collections

About this viewer

MolViewer shows 3WN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.