Crystal structure of CYLD USP domain (C596S) in complex with Met1-linked diubiquitin. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 Feb 2015.
Explore 3WXE in 3D Show helices and sheets RCSB PDB PDBe
3WXE contains 23 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 584-585 | 2 | 1 |
| β-strand | 588-589 | 2 | 2 |
| α-helix | 590-591 | 2 | |
| α-helix | 596-606 | 11 | |
| α-helix | 614-617 | 4 | |
| α-helix | 618-620 | 3 | |
| α-helix | 628-634 | 7 | |
| α-helix | 635-640 | 6 | |
| α-helix | 641-646 | 6 | |
| β-strand | 648-649 | 2 | 2 |
| α-helix | 651-664 | 14 | |
| α-helix | 677-682 | 6 | |
| α-helix | 683-688 | 6 | |
| β-strand | 695-699 | 5 | 3 |
| β-strand | 705-707 | 3 | 3 |
| β-strand | 710-711 | 2 | 1 |
| β-strand | 724 | 1 | 4 |
| α-helix | 725-735 | 11 | |
| β-strand | 738-740 | 3 | 3 |
| β-strand | 746-750 | 5 | 1 |
| β-strand | 753 | 1 | 5 |
| β-strand | 759 | 1 | 5 |
| β-strand | 765 | 1 | 4 |
| β-strand | 769-771 | 3 | 1 |
| α-helix | 773-775 | 3 | |
| β-strand | 776 | 1 | 3 |
| β-strand | 788-797 | 10 | 1 |
| β-strand | 802-807 | 6 | 1 |
| β-strand | 815-825 | 11 | 1 |
| β-strand | 831-838 | 8 | 1 |
| α-helix | 841-845 | 5 | |
| α-helix | 850-854 | 5 | |
| α-helix | 858-860 | 3 | |
| α-helix | 865-870 | 6 | |
| β-strand | 872-878 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 12-15 | 4 | 6 |
| β-strand | 22 | 1 | 7 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-44 | 4 | 6 |
| β-strand | 49 | 1 | 6 |
| α-helix | 50-51 | 2 | |
| β-strand | 55 | 1 | 7 |
| α-helix | 57-59 | 3 | |
| β-strand | 66-71 | 6 | 6 |
| β-strand | 77-82 | 6 | 8 |
| β-strand | 88-93 | 6 | 8 |
| β-strand | 98 | 1 | 9 |
| α-helix | 99-110 | 12 | |
| α-helix | 114-116 | 3 | |
| β-strand | 117-121 | 5 | 8 |
| β-strand | 124-125 | 2 | 8 |
| β-strand | 131 | 1 | 9 |
| α-helix | 133-135 | 3 | |
| β-strand | 142-147 | 6 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uncharacterized protein | A | protein | 312 | Danio rerio | E7FEV5 (AlphaFold model) |
| Ubiquitin | B | protein | 148 | Homo sapiens | P0CG48 (AlphaFold model) |
>3WXE_1 Uncharacterized protein (chains A) SHMGLEVMVGKKKGIQGHYNSSYLDSTLFCLFSFSSVLDTVLLRPRSKTDVEYYKETQEL LRTEIVNPLRIHGYVCATKIMKLRRILEKVEAASGFTSEEKDPEEFLNILFHHILRVDPL LRLRSAGQKVQDCYFYQIFMDKKDKVMVPTSQQLLEWSFINSDLKFAEAPSCLIIQMPRF GKDFKMFNKIFPSLELDITDLLDDTPLEGGPHQQMELFAVLCIETSHYVAFVKYGSADSA WLFFDSMADRDGGQNGFNIPQVSRCPEVGEYLKMTPEELHALDPKNIQGYARRLLCDAYM CMYQSPTMSLYK
>3WXE_2 Ubiquitin (chains B) MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLR
Structures of CYLD USP with Met1- or Lys63-linked diubiquitin reveal mechanisms for dual specificity. Sato, Y., Goto, E., Shibata, Y. et al. Nat Struct Mol Biol (2015) 22:222-229. DOI 10.1038/nsmb.2970 · PubMed
Other PDB entries of the same protein (UniProt E7FEV5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3WXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.