Crystal structure of Dynamin. Determined by X-ray diffraction at 3.1 Å resolution. Released 21 Sept 2011.
Explore 3ZVR in 3D Show helices and sheets RCSB PDB PDBe
3ZVR contains 31 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| α-helix | 9-21 | 13 | |
| α-helix | 27-29 | 3 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 44-52 | 9 | |
| β-strand | 69-75 | 7 | 1 |
| β-strand | 80-82 | 3 | 1 |
| β-strand | 91 | 1 | 1 |
| α-helix | 94-109 | 16 | |
| β-strand | 120-126 | 7 | 1 |
| β-strand | 132-136 | 5 | 1 |
| α-helix | 142-144 | 3 | |
| α-helix | 148-150 | 3 | |
| α-helix | 151-164 | 14 | |
| β-strand | 169-176 | 8 | 1 |
| α-helix | 185-193 | 9 | |
| β-strand | 200-205 | 6 | 1 |
| α-helix | 211 | 1 | |
| α-helix | 217-220 | 4 | |
| β-strand | 231-233 | 3 | 1 |
| β-strand | 240-241 | 2 | 2 |
| β-strand | 246-247 | 2 | 2 |
| α-helix | 248-261 | 14 | |
| α-helix | 266-271 | 6 | |
| α-helix | 274-317 | 44 | |
| α-helix | 326-344 | 19 | |
| α-helix | 358-364 | 7 | |
| α-helix | 365-369 | 5 | |
| α-helix | 370-375 | 6 | |
| α-helix | 379-380 | 2 | |
| α-helix | 381-394 | 14 | |
| α-helix | 404-418 | 15 | |
| α-helix | 421-442 | 22 | |
| α-helix | 443-446 | 4 | |
| α-helix | 450-483 | 34 | |
| β-strand | 520-528 | 9 | 3 |
| β-strand | 540-546 | 7 | 3 |
| β-strand | 549-553 | 5 | 3 |
| β-strand | 561-566 | 6 | 3 |
| β-strand | 570-574 | 5 | 3 |
| β-strand | 584-590 | 7 | 3 |
| β-strand | 597 | 1 | 4 |
| β-strand | 600 | 1 | 4 |
| β-strand | 602-607 | 6 | 3 |
| α-helix | 610-622 | 13 | |
| β-strand | 627 | 1 | 3 |
| α-helix | 654-685 | 32 | |
| α-helix | 686-690 | 5 | |
| α-helix | 691-695 | 5 | |
| α-helix | 696-701 | 6 | |
| α-helix | 702-707 | 6 | |
| α-helix | 719-742 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Dynamin-1 | A | protein | 772 | RATTUS NORVEGICUS | P21575 (AlphaFold model) |
>3ZVR_1 DYNAMIN-1 (chains A) MGSSHHHHHHSSGLVPRGSHMGNRGMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQ SAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNSTTEYAEFLHCKGKKFTDFEEVRLE IEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDML MQFVTKENCLILAVSPANSDLANSDALKIAKEVDPQGQRTIGVITKLDLMDEGTDARDVL ENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKV LNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVDEYKNFRPDDPARKTKALLQMVQQFAVDF EKRIEGSGDQIDTYELSGGARINRIFHERFPFELVKMEFDEKELRREISYAIKNIHDIRT GLFTPDLAFEATVKKQVQKLKEPSIKCVDMVVSELTSTIRKCSEKLQQYPRLREEMERIV TTHIREREGRTKEQVMLLIDIELAYMNTNHEDFIGFANAQQRSNQMNKKKTSGNQDEILV IRKGWLTINNIGIMKGGSKEYWFVLTAENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFM SSKHIFALFNTEQRNVYKDYRQLELACETQEEVDSWKASFLRAGVYPERVGDKEKASETE ENGSDSFMHSMDPQLERQVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFIFSE LLANLYSCGDQNTLMEESAEQAQRRDEMLRMYHALKEALSIIGDINTTTVST
The Crystal Structure of Dynamin. Ford, M.G.J., Jenni, S., Nunnari, J. Nature (2011) 477:561. DOI 10.1038/NATURE10441 · PubMed
Other PDB entries of the same protein (UniProt P21575 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ZVR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.