3ZWL: PDB entry 3ZWL

Name: PDB 3ZWL: Structure of eukaryotic translation initiation factor eIF3i complex with eIF3b C-terminus (655-700)
Published: 2011-10-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

Structure of eukaryotic translation initiation factor eIF3i complex with eIF3b C-terminus (655-700). Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Oct 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 4
Atoms: 6,381
Mol. weight: 94.73 kDa
Released: 5 Oct 2011

Explore 3ZWL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ZWL contains 12 α-helices and 62 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 5 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	13-18	6	2
β-strand	24-29	6	2
β-strand	34-38	5	2
β-strand	44-48	5	2
β-strand	55-60	6	3
β-strand	66-71	6	3
β-strand	75-80	6	3
β-strand	86-91	6	3
β-strand	96-101	6	4
β-strand	107-112	6	4
α-helix	113-114	2
β-strand	115	1	5
β-strand	118	1	5
β-strand	121-126	6	4
β-strand	127-129	3	6
β-strand	136-139	4	6
β-strand	145-148	4	4
β-strand	156-161	6	7
α-helix	163-165	3
β-strand	167-172	6	7
β-strand	176-181	6	7
β-strand	187-193	7	7
β-strand	199-204	6	8
β-strand	210-215	6	8
β-strand	219-224	6	8
β-strand	230-235	6	8
β-strand	240-245	6	9
α-helix	246	1
β-strand	251-256	6	9
β-strand	274-279	6	9
β-strand	285-290	6	9
β-strand	296-301	6	1
β-strand	307-312	6	1
β-strand	316-322	7	1
α-helix	324-327	4
α-helix	332-339	8

Chain D: 5 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1-6	6	10
β-strand	13-18	6	11
β-strand	24-29	6	11
β-strand	34-38	5	11
β-strand	44-48	5	11
β-strand	55-60	6	12
β-strand	66-71	6	12
β-strand	75-80	6	12
β-strand	85-91	7	12
β-strand	96-101	6	13
β-strand	107-112	6	13
α-helix	113	1
β-strand	121-126	6	13
β-strand	127-129	3	14
β-strand	136-139	4	14
β-strand	145-148	4	13
β-strand	156-161	6	15
α-helix	163-165	3
β-strand	167-172	6	15
β-strand	176-181	6	15
β-strand	187-193	7	15
β-strand	199-204	6	16
β-strand	210-215	6	16
β-strand	219-224	6	16
β-strand	230-235	6	16
β-strand	240-245	6	17
α-helix	246	1
β-strand	251-256	6	17
β-strand	273-279	7	17
β-strand	285-292	8	17
β-strand	296-301	6	10
β-strand	307-312	6	10
β-strand	317-322	6	10
α-helix	324-327	4
α-helix	332-339	8

Chains E and F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	663-689	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic translation initiation factor 3 subunit I	B, D	protein	369	SACCHAROMYCES CEREVISIAE	P40217 (AlphaFold model)
Eukaryotic translation initiation factor 3 subunit B	E, F	protein	50	SACCHAROMYCES CEREVISIAE	P06103 (AlphaFold model)

Sequence of entity 1 (B, D), FASTA

>3ZWL_1 EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT I (chains B, D)
MGSSHHHHHHSSGENLYFQGSHMKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWY
SLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKR
VEFSPCGNYFLAILDNVMKNPGSINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATV
AGWSTKGKYIIAGHKDGKISKYDVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDT
NSFLVDVSTLQVLKKYETDCPLNTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFY
HKIFEEEIGRVQGHFGPLNTVAISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAE
AKEHMQEAN

Sequence of entity 2 (E, F), FASTA

>3ZWL_2 EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT B (chains E, F)
GSHMEADTAMRDLILHQRELLKQWTEYREKIGQEMEKSMNFKIFDVQPED

Primary citation

Structural Analysis of an Eif3 Subcomplex Reveals Conserved Interactions Required for a Stable and Proper Translation Pre-Initiation Complex Assembly. Herrmannova, A., Daujotyte, D., Yang, J.C. et al. Nucleic Acids Res (2012) 40:2294. DOI 10.1093/NAR/GKR765 · PubMed

Other PDB entries of the same protein (UniProt P40217 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CAH 3.0 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 43S pre-initiation complex
8CAS 3.3 Å, Cryo-EM structure of native Otu2-bound ubiquitinated 48S initiation complex (partial)
6FYX 3.5 Å, Structure of a partial yeast 48S preinitiation complex with eIF5 N-terminal domain…
3JAP 4.9 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
6GSM 5.15 Å, Structure of a partial yeast 48S preinitiation complex in open conformation.
6ZCE 5.3 Å, Structure of a yeast ABCE1-bound 43S pre-initiation complex
6GSN 5.75 Å, Structure of a partial yeast 48S preinitiation complex in closed conformation
9CPA 6.0 Å, Structure of a Mammalian DHX29-bound 43S Pre-initiation Complex
6ZU9 6.2 Å, Structure of a yeast ABCE1-bound 48S initiation complex
5A5U 9.0 Å, Structure of mammalian eIF3 in the context of the 43S preinitiation complex

Browse structure collections

About this viewer

MolViewer shows 3ZWL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.