4AM7: Actin-like protein ARP8

ADP-bound C-terminal domain of actin-related protein ARP8 from S. Cerevisiae. Determined by X-ray diffraction at 3.25 Å resolution. Released 12 Dec 2012.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 10,126
Mol. weight: 150.48 kDa
Ligands: ADP
Released: 12 Dec 2012

Explore 4AM7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AM7 contains 73 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	265-267	3
β-strand	268-272	5	1
β-strand	277-281	5	1
β-strand	289-292	4	1
β-strand	295-298	4	2
α-helix	299-301	3
α-helix	321-341	21
α-helix	352-354	3
β-strand	358-359	2	3
α-helix	360-361	2
β-strand	377	1	4
β-strand	384-385	2	2
α-helix	387-390	4
β-strand	392	1	4
β-strand	397-400	4	2
β-strand	403-404	2	5
β-strand	407-408	2	5
α-helix	418-433	16
β-strand	434	1	6
β-strand	439	1	6
α-helix	442-447	6
β-strand	449-454	6	1
α-helix	460-472	13
β-strand	478-483	6	1
α-helix	484-490	7
β-strand	498-503	6	7
β-strand	508-514	7	7
β-strand	517-526	10	7
α-helix	530-543	14
α-helix	556-569	14
α-helix	574-576	3
β-strand	580-586	7	3
β-strand	594-600	7	3
α-helix	603-609	7
α-helix	610-612	3
α-helix	615-619	5
α-helix	622-624	3
α-helix	628-631	4
α-helix	635-637	3
β-strand	638	1	8
β-strand	645	1	8
α-helix	651-657	7
α-helix	662-664	3
α-helix	668-675	8
α-helix	678-686	9
α-helix	703-716	14
α-helix	720-722	3
α-helix	723-727	5
β-strand	730-733	4	7
α-helix	735-738	4
α-helix	742-753	12
α-helix	756-758	3
β-strand	760	1	9
α-helix	763-778	16
α-helix	798-814	17
β-strand	824	1	9
β-strand	829-830	2	7
α-helix	831-833	3
α-helix	838-840	3
α-helix	841-849	9
α-helix	854-858	5
β-strand	860-861	2	1
α-helix	862-868	7
α-helix	869-874	6

Chain B: 36 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	265-267	3
β-strand	268-273	6	10
β-strand	277-281	5	10
α-helix	288	1
β-strand	289-292	4	10
β-strand	295-298	4	11
α-helix	299-301	3
β-strand	315	1	12
α-helix	321-341	21
β-strand	377	1	13
β-strand	384-385	2	11
α-helix	387-390	4
β-strand	392	1	13
β-strand	397-400	4	11
β-strand	403	1	14
β-strand	408	1	14
α-helix	418-432	15
α-helix	442-447	6
β-strand	449-454	6	10
α-helix	460-468	9
α-helix	469-473	5
β-strand	478-479	2	15
β-strand	480-483	4	10
α-helix	484-491	8
β-strand	498-503	6	16
β-strand	508-513	6	16
β-strand	518	1	16
α-helix	520-522	3
β-strand	524-526	3	16
α-helix	530-542	13
β-strand	552	1	12
α-helix	556-569	14
β-strand	580-584	5	17
β-strand	596-600	5	17
α-helix	603-609	7
α-helix	610-612	3
α-helix	615-620	6
α-helix	622-624	3
α-helix	628-633	6
α-helix	635-637	3
β-strand	638	1	18
β-strand	645	1	18
α-helix	651-658	8
α-helix	668-676	9
α-helix	678-685	8
α-helix	703-717	15
α-helix	720-722	3
α-helix	723-727	5
β-strand	730-731	2	19
β-strand	732-733	2	16
α-helix	742-753	12
α-helix	756-759	4
β-strand	760	1	20
α-helix	763-772	10
α-helix	776-779	4
α-helix	797-813	17
β-strand	824	1	20
β-strand	829-830	2	19
α-helix	831-832	2
α-helix	841-849	9
α-helix	855-857	3
β-strand	860-861	2	15
α-helix	862-868	7
α-helix	869-871	3
α-helix	872-875	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-like protein ARP8	A, B	protein	655	SACCHAROMYCES CEREVISIAE	Q12386 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4AM7_1 ACTIN-LIKE PROTEIN ARP8 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMHSEASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDD
HPVVVPNCVAVPKKWLDLENSEHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVP
GNAHEQVVSFNENSKPEIISEKNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPFRGG
SFNVKSPYYKSLAELISDVTKLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETF
IRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITL
DYGGDDITRLFALFLLQSDFPLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMN
RSPNQPTEKYEFKLFDEVMLAPLALFFPQIFKLIRTSSHKNSSLEFQLPESRDLFTNELN
DWNSLSQFESKEGNLYCDLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKA
IVQSIANASITADVTRMNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQF
YKKLTKEIKDLEGHYVNAPDKTEDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFP
VSIIPPPRDMNPALIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2

Primary citation

Interactions between the Nucleosome Histone Core and Arp8 in the Ino80 Chromatin Remodeling Complex. Saravanan, M., Wuerges, J., Bose, D. et al. Proc Natl Acad Sci U S A (2012) 109:20883. DOI 10.1073/PNAS.1214735109 · PubMed

Other PDB entries of the same protein (UniProt Q12386 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4AM6 2.7 Å, C-terminal domain of actin-related protein ARP8 from S. Cerevisiae
8A5O 3.2 Å, Structure of Arp4-Ies4-N-actin-Arp8-Ino80HSA subcomplex (A-module) of S. cerevisiae INO80
8A5A 3.3 Å, Structure of Arp4-Ies4-N-actin-Arp8-Ino80HSA subcomplex (A-module) of INO80
5NBN 4.0 Å, Crystal structure of the Arp4-N-actin-Arp8-Ino80HSA module of INO80

Browse structure collections

About this viewer

MolViewer shows 4AM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.