Laminin beta1 LN-LE1-4 structure. Determined by X-ray diffraction at 3.11 Å resolution. Released 15 Aug 2012.
Explore 4AQS in 3D Show helices and sheets RCSB PDB PDBe
4AQS contains 13 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 30-32 | 3 | |
| β-strand | 35 | 1 | 1 |
| α-helix | 37-39 | 3 | |
| β-strand | 40-41 | 2 | 2 |
| α-helix | 47-49 | 3 | |
| β-strand | 50-51 | 2 | 2 |
| β-strand | 62-67 | 6 | 3 |
| β-strand | 74-79 | 6 | 3 |
| β-strand | 86 | 1 | 4 |
| β-strand | 90 | 1 | 4 |
| α-helix | 96-98 | 3 | |
| β-strand | 112-113 | 2 | 2 |
| β-strand | 122-140 | 19 | 2 |
| β-strand | 147-153 | 7 | 2 |
| β-strand | 161-167 | 7 | 2 |
| β-strand | 190-191 | 2 | 2 |
| β-strand | 204-208 | 5 | 2 |
| α-helix | 222-228 | 7 | |
| β-strand | 229-239 | 11 | 2 |
| α-helix | 252-255 | 4 | |
| β-strand | 261-270 | 10 | 2 |
| β-strand | 276 | 1 | 1 |
| β-strand | 280-281 | 2 | 5 |
| α-helix | 293-295 | 3 | |
| β-strand | 297-298 | 2 | 5 |
| β-strand | 304-305 | 2 | 6 |
| β-strand | 311-312 | 2 | 6 |
| α-helix | 313 | 1 | |
| β-strand | 325 | 1 | 7 |
| β-strand | 328 | 1 | 7 |
| α-helix | 331-335 | 5 | |
| β-strand | 343-346 | 4 | 8 |
| α-helix | 348-353 | 6 | |
| β-strand | 360-363 | 4 | 8 |
| β-strand | 369-370 | 2 | 9 |
| β-strand | 376-377 | 2 | 9 |
| β-strand | 381-383 | 3 | 10 |
| β-strand | 395-397 | 3 | 10 |
| β-strand | 405 | 1 | 11 |
| α-helix | 407-409 | 3 | |
| β-strand | 416 | 1 | 12 |
| α-helix | 417-419 | 3 | |
| β-strand | 421 | 1 | 12 |
| β-strand | 428 | 1 | 11 |
| β-strand | 432-433 | 2 | 13 |
| β-strand | 439-440 | 2 | 13 |
| α-helix | 441 | 1 | |
| β-strand | 444-445 | 2 | 14 |
| β-strand | 456-457 | 2 | 14 |
| β-strand | 465 | 1 | 15 |
| β-strand | 472 | 1 | 16 |
| β-strand | 479 | 1 | 16 |
| β-strand | 481 | 1 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Laminin subunit beta-1 | A | protein | 525 | MUS MUSCULUS | P02469 (AlphaFold model) |
>4AQS_1 LAMININ SUBUNIT BETA-1 (chains A) APLAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQEDKKCF ICDSRDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLI MTFKTFRPAAMLIERSSDFGKAWGVYRYFAYDCESSFPGISTGPMKKVDDIICDSRYSDI EPSTEGEVIFRALDPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREK YYYAVYDMVVRGNCFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYH DLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQC KPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERC DVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQH WGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCSCLPHMIGRQCNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Crystal Structures of the Network-Forming Short-Arm Tips of the Laminin Beta1 and Gamma1 Chains. Carafoli, F., Hussain, S., Hohenester, E. PLoS One (2012) 7:42473. DOI 10.1371/JOURNAL.PONE.0042473 · PubMed
Other PDB entries of the same protein (UniProt P02469 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4AQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.