4AU7: Suv4-20h2 ternary complex with histone H4

Name: PDB 4AU7: The structure of the Suv4-20h2 ternary complex with histone H4
Published: 2013-05-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

The structure of the Suv4-20h2 ternary complex with histone H4. Determined by X-ray diffraction at 2.07 Å resolution. Released 22 May 2013.

Method: X-ray diffraction
Resolution: 2.07 Å
Organism: MUS MUSCULUS
Chains: 3
Atoms: 3,917
Mol. weight: 59.17 kDa
Ligands: ZN, SAH
Released: 22 May 2013

Explore 4AU7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AU7 contains 30 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-23	5
α-helix	24-27	4
α-helix	41-44	4
α-helix	45-58	14
α-helix	61-68	8
α-helix	74-77	4
α-helix	83-99	17
α-helix	102-104	3
β-strand	106-111	6	1
β-strand	120-125	6	1
β-strand	129	1	2
β-strand	134-144	11	3
α-helix	147-152	6
β-strand	162-165	4	3
β-strand	170-175	6	3
α-helix	177-180	4
α-helix	181	1
β-strand	182-183	2	3
β-strand	189-193	5	3
β-strand	198-203	6	3
β-strand	207	1	2
α-helix	211	1
β-strand	212	1	1
α-helix	213	1
β-strand	214-215	2	3
α-helix	232-237	6
α-helix	240-243	4

Chain B: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
α-helix	19-23	5
α-helix	24-27	4
α-helix	41-44	4
α-helix	45-58	14
α-helix	61-68	8
α-helix	73-79	7
α-helix	83-99	17
α-helix	102-104	3
β-strand	106-110	5	4
β-strand	121-125	5	4
β-strand	129	1	5
β-strand	134-144	11	6
α-helix	147-152	6
β-strand	162-163	2	6
β-strand	172-175	4	6
α-helix	177-180	4
α-helix	181	1
β-strand	182-183	2	7
β-strand	189-193	5	6
β-strand	198-203	6	6
β-strand	207	1	5
α-helix	211	1
β-strand	212	1	4
α-helix	213	1
β-strand	214-215	2	7

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	20-22	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone-lysine N-methyltransferase SUV420H2	A, B	protein	247	MUS MUSCULUS	Q6Q783 (AlphaFold model)
Histone H4 peptide	C	protein	9	MUS MUSCULUS	P62806 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4AU7_1 HISTONE-LYSINE N-METHYLTRANSFERASE SUV420H2 (chains A, B)
SMGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPTLRRQHHLRSALEAFLRQR
DLEAAFRALTLGGWMAHYFQSRAPRQEAALKTHIFCYLRAFLPESGFTILPCTRYSMETN
GAKIVSTRAWKKNEKLELLVGCIAELREEDEDLLRAGENDFSIMYSTRKRSAQLWLGPAA
FINHDCKPNCKFVPSDGNTACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGE
GAFRLQP

Sequence of entity 2 (C), FASTA

>4AU7_2 HISTONE H4 PEPTIDE (chains C)
RHRKVLRDY

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	3
SAH	S-adenosyl-L-homocysteine	C14 H20 N6 O5 S	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

A Novel Route to Product Specificity in the Suv4-20 Family of Histone H4K20 Methyltransferases. Southall, S.M., Cronin, N.B., Wilson, J.R. Nucleic Acids Res (2014) 42:661. DOI 10.1093/NAR/GKT776 · PubMed

Browse structure collections

About this viewer

MolViewer shows 4AU7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.