4AZ9: Phox homology domain of human sorting nexin 24

Crystal structure of phox homology domain of human sorting nexin 24. Determined by X-ray diffraction at 1.75 Å resolution. Released 10 Oct 2012.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,186
Mol. weight: 31.14 kDa
Released: 10 Oct 2012

Explore 4AZ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AZ9 contains 10 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	1
β-strand	19-28	10	1
β-strand	31-38	8	1
α-helix	39-49	11
α-helix	54-57	4
α-helix	68-88	21
α-helix	94-99	6

Chain B: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	-6--2	5
β-strand	2-11	10	2
α-helix	17-18	2
β-strand	19-28	10	2
β-strand	31-37	7	2
α-helix	39-49	11
α-helix	54-60	7
α-helix	68-88	21
α-helix	94-99	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-24	A, B	protein	129	HOMO SAPIENS	Q9Y343 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4AZ9_1 SORTING NEXIN-24 (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKR
YSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLD
FLNVRHLPS

Primary citation

Crystal Structure of Phox Homology Domain of Human Sorting Nexin 24. Oberholzer, A.E., Kiyani, W., Krojer, T. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y343 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8TBW 2.08 Å, Human Class I MHC HLA-A2 in complex with sorting nexin 24 (127-135) peptide KLSHQPVLL
8TBV 2.64 Å, Human Class I MHC HLA-A2 in complex with sorting nexin 24 (127-135) neoantigen KLSHQLVLL
8U9G 2.87 Å, Human Class I MHC HLA-A2 bound to sorting nexin 24 (127-135) neoantigen KLSHQLVLL

Browse structure collections

About this viewer

MolViewer shows 4AZ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.