Structure of the factor Xa-like trypsin variant triple-Ala (TPA) in complex with eglin C. Determined by X-ray diffraction at 1.43 Å resolution. Released 1 Aug 2012.
Explore 4B2C in 3D Show helices and sheets RCSB PDB PDBe
4B2C contains 22 α-helices and 58 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| β-strand | 30-34 | 5 | 3 |
| β-strand | 40-48 | 9 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 64-67 | 4 | 3 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 115 | 1 | 4 |
| β-strand | 118 | 1 | 4 |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-124 | 2 | |
| α-helix | 128-130 | 3 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 151 | 1 | 5 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-201 | 4 | 2 |
| β-strand | 204-217 | 10 | 2 |
| β-strand | 221A | 1 | 6 |
| β-strand | 224 | 1 | 6 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-244 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 5 |
| α-helix | 6-8 | 3 | |
| β-strand | 9 | 1 | 7 |
| α-helix | 11-13 | 3 | |
| β-strand | 17 | 1 | 7 |
| α-helix | 18-28 | 11 | |
| β-strand | 33-38 | 6 | 7 |
| β-strand | 42-44 | 3 | 2 |
| β-strand | 51-57 | 7 | 7 |
| β-strand | 62-63 | 2 | 7 |
| β-strand | 68-69 | 2 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 8 |
| β-strand | 20-21 | 2 | 9 |
| β-strand | 30-34 | 5 | 10 |
| β-strand | 40-48 | 9 | 10 |
| β-strand | 51-54 | 4 | 10 |
| α-helix | 56-58 | 3 | |
| α-helix | 63 | 1 | |
| β-strand | 64-67 | 4 | 10 |
| β-strand | 81-90 | 10 | 10 |
| β-strand | 104-108 | 5 | 10 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 11 |
| β-strand | 118 | 1 | 11 |
| β-strand | 122 | 1 | 9 |
| α-helix | 123-124 | 2 | |
| α-helix | 128-130 | 3 | |
| β-strand | 135-140 | 6 | 9 |
| β-strand | 151 | 1 | 12 |
| β-strand | 156-162 | 7 | 9 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 9 |
| β-strand | 189 | 1 | 8 |
| β-strand | 198-201 | 4 | 9 |
| β-strand | 204-217 | 10 | 9 |
| β-strand | 221A | 1 | 13 |
| β-strand | 224 | 1 | 13 |
| β-strand | 226-230 | 5 | 9 |
| α-helix | 231-233 | 3 | |
| α-helix | 235-244 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cationic trypsin | A, C | protein | 223 | BOS TAURUS | P00760 (AlphaFold model) |
| Eglin C | B, D | protein | 71 | HIRUDO MEDICINALIS | P01051 (AlphaFold model) |
>4B2C_1 CATIONIC TRYPSIN (chains A, C) IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG NEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG WGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDAGGP VVCSGKLQGIVSWGSGCAQKNKPGFYTKVCNYVSWIKQTIASN
>4B2C_2 EGLIN C (chains B, D) GTEFGSELKSFPEVVGKTVDQAREYFTLHYPQYDVYFLPEGSPVTKDLRYNRVRVFYNPG TNVVNHVPHVG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Water and common crystallization additives (GOL, CL, EDO) are not listed.
Thermodynamic signatures in macromolecular interactions involving conformational flexibility. Menzel, A., Neumann, P., Schwieger, C. et al. Biol Chem (2014) 395:905-911. DOI 10.1515/hsz-2014-0177 · PubMed
Other PDB entries of the same protein (UniProt P00760 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4B2C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.