4B53: Isolated IgG4 CH3 domain

Crystal structure of the isolated IgG4 CH3 domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 5 Dec 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,941
Mol. weight: 25.04 kDa
Released: 5 Dec 2012

Explore 4B53 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B53 contains 12 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	344	1	1
α-helix	345-346	2
β-strand	347-351	5	2
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	2
β-strand	373	1	1
β-strand	378-383	6	3
β-strand	386-387	2	3
β-strand	391-393	3	2
α-helix	394-396	3
β-strand	397-398	2	2
β-strand	404-413	10	2
α-helix	414-418	5
β-strand	423-428	6	3
α-helix	433-435	3
β-strand	436-441	6	3

Chain B: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	344	1	4
α-helix	345-346	2
β-strand	347-351	5	5
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	5
β-strand	373	1	4
β-strand	378-383	6	6
β-strand	386-388	3	6
β-strand	391-393	3	5
α-helix	394-396	3
β-strand	397-398	2	5
β-strand	404-413	10	5
α-helix	414-418	5
β-strand	423-428	6	6
α-helix	433-435	3
β-strand	436-441	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-4 chain C region	A, B	protein	106	HOMO SAPIENS	P01861 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4B53_1 IG GAMMA-4 CHAIN C REGION (chains A, B)
QPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK

Primary citation

Crystal Structure of the Human Igg4 C(H)3 Dimer Reveals the Role of Arg409 in the Mechanism of Fab-Arm Exchange. Davies, A.M., Rispens, T., Den Bleker, T.H. et al. Mol Immunol (2012) 54:1. DOI 10.1016/J.MOLIMM.2012.10.029 · PubMed

Other PDB entries of the same protein (UniProt P01861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EO0 1.75 Å, Structure of the Transforming Growth Factor-Beta Neutralizing Antibody GC-1008
5W5N 1.85 Å, Crystal structure of human IgG4-Sigma2 Fc fragment
4C54 1.9 Å, Crystal structure of recombinant human IgG4 Fc
5W5M 1.9 Å, Crystal structure of human IgG4-Sigma1 Fc fragment
5HVW 1.95 Å, Monomeric IgG4 Fc
3X3F 2.1 Å, TRAIL-R2 Extracellular Region Complexed to a Fab fragment from Human Agonist Antibody…
6WMH 2.3 Å, Next generation monomeric IgG4 Fc
4C55 2.35 Å, Crystal structure of serum-derived human IgG4 Fc
6WNA 2.4 Å, Next generation monomeric IgG4 Fc
6WOL 2.49 Å, Next generation monomeric IgG4 Fc bound to neonatal Fc receptor
3X3G 2.51 Å, Fab fragment from anti TRAIL-R2 Human Agonist Antibody KMTR2
6WIB 2.55 Å, Next generation monomeric IgG4 Fc

Browse structure collections

About this viewer

MolViewer shows 4B53 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.