4B89: MIF4G domain of the yeast Not1

MIF4G domain of the yeast Not1. Determined by X-ray diffraction at 1.5 Å resolution. Released 21 Nov 2012.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: SACCHAROMYCES CEREVISIAE S288C
Chains: 1
Atoms: 2,172
Mol. weight: 28.53 kDa
Released: 21 Nov 2012

Explore 4B89 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4B89 contains 21 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	771	1	1
β-strand	777	1	2
α-helix	780-783	4
α-helix	787-788	2
α-helix	790-792	3
α-helix	793-805	13
α-helix	811-821	11
α-helix	824-826	3
α-helix	827-833	7
α-helix	834-839	6
α-helix	843-845	3
α-helix	846-856	11
α-helix	859-877	19
β-strand	879	1	1
α-helix	882-884	3
α-helix	887-900	14
α-helix	902-904	3
α-helix	907-909	3
β-strand	913	1	2
α-helix	915-925	11
α-helix	928-939	12
α-helix	940-942	3
α-helix	953-968	16
α-helix	973-985	13
α-helix	990-992	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
General negative regulator of transcription subunit 1	A	protein	249	SACCHAROMYCES CEREVISIAE S288C	P25655 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4B89_1 GENERAL NEGATIVE REGULATOR OF TRANSCRIPTION SUBUNIT 1 (chains A)
RSMSRPVQEMIPLKFFAVDEVSCQINQEGAPKDVVEKVLFVLNNVTLANLNNKVDELKKS
LTPNYFSWFSTYLVTQRAKTEPNYHDLYSKVIVAMGSGLLHQFMVNVTLRQLFVLLSTKD
EQAIDKKHLKNLASWLGCITLALNKPIKHKNIAFREMLIEAYKENRLEIVVPFVTKILQR
ASESKIFKPPNPWTVGILKLLIELNEKANWKLSLTFEVEVLLKSFNLTTKSLKPSNFINT
PEVIETLSG

Primary citation

Architecture of the Nuclease Module of the Yeast Ccr4-not Complex: The not1-Caf1-Ccr4 Interaction. Basquin, J., Roudko, V.V., Rode, M. et al. Mol Cell (2012) 48:207. DOI 10.1016/J.MOLCEL.2012.08.014 · PubMed

Other PDB entries of the same protein (UniProt P25655 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4B8A 2.4 Å, Structure of yeast NOT1 MIF4G domain co-crystallized with CAF1
4BY6 2.8 Å, Yeast Not1-Not2-Not5 complex
4B8B 2.8 Å, N-Terminal domain of the yeast Not1
4B8C 3.41 Å, nuclease module of the yeast Ccr4-Not complex
5AJD 3.62 Å, Not1 C-terminal domain in complex with Not4
4CV5 3.81 Å, yeast NOT1 CN9BD-CAF40 complex

Browse structure collections

About this viewer

MolViewer shows 4B89 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.