rImp_alpha1a. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Jan 2013.
Explore 4B8J in 3D Show helices and sheets RCSB PDB PDBe
4B8J contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 74-81 | 8 | |
| α-helix | 86-100 | 15 | |
| α-helix | 108-113 | 6 | |
| α-helix | 117-124 | 8 | |
| α-helix | 130-144 | 15 | |
| α-helix | 148-156 | 9 | |
| α-helix | 159-166 | 8 | |
| α-helix | 172-187 | 16 | |
| α-helix | 190-198 | 9 | |
| α-helix | 202-207 | 6 | |
| α-helix | 215-229 | 15 | |
| α-helix | 234-236 | 3 | |
| α-helix | 237-240 | 4 | |
| α-helix | 243-250 | 8 | |
| α-helix | 256-269 | 14 | |
| α-helix | 274-282 | 9 | |
| α-helix | 286-292 | 7 | |
| α-helix | 298-311 | 14 | |
| α-helix | 316-323 | 8 | |
| α-helix | 327-336 | 10 | |
| α-helix | 341-355 | 15 | |
| α-helix | 359-367 | 9 | |
| α-helix | 371-380 | 10 | |
| α-helix | 383-399 | 17 | |
| α-helix | 402-410 | 9 | |
| α-helix | 414-419 | 6 | |
| α-helix | 420-422 | 3 | |
| α-helix | 426-450 | 25 | |
| α-helix | 456-463 | 8 | |
| α-helix | 466-472 | 7 | |
| α-helix | 473-475 | 3 | |
| α-helix | 479-492 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Importin subunit alpha-1A | A | protein | 528 | ORYZA SATIVA JAPONICA GROUP | Q71VM4 (AlphaFold model) |
>4B8J_1 IMPORTIN SUBUNIT ALPHA-1A (chains A) GSMSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREESLLKKRREGLQAQAP VPASAATGVDKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSIERSPPIEEVIQSGVVP RFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAVPIFVKLLGSSSDDVREQA VWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSMLRNATWTLSNFCRGKPQPSFE QTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDKIQAVIEAGVCPRLVELLLHPSP SVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSLLTQNLKKSIKKEACWTISNITAGN KDQIQAVINAGIIGPLVNLLQTAEFDIKKEAAWAISNATSGGSHDQIKYLVSEGCIKPLC DLLICPDIRIVTVCLEGLENILKVGETDKTLAAGDVNVFSQMIDEAEGLEKIENLQSHDN NEIYEKAVKILEAYWMDEEDDTMGATTVAAPQGATFDFGQGGGAAQFK
Crystal Structure of Rice Importin-Alpha and Structural Basis of its Interaction with Plant-Specific Nuclear Localization Signals. Chang, C.-W., Counago, R.L.M., Williams, S.J. et al. Plant Cell (2012) 24:5074. DOI 10.1105/TPC.112.104422 · PubMed
Other PDB entries of the same protein (UniProt Q71VM4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4B8J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.