4BD3: Phd finger protein 19

Phf19 links methylated lysine 36 of histone H3 to regulation of Polycomb activity. Determined by solution NMR. Released 31 Oct 2012.

Method: Solution NMR
Organism: HOMO SAPIENS
Chains: 2
Atoms: 563
Mol. weight: 7.98 kDa
Released: 31 Oct 2012

Explore 4BD3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BD3 contains 1 α-helix and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	45-49	5	1
β-strand	55-64	10	1
β-strand	69-74	6	1
β-strand	79-83	5	1
α-helix	84-86	3
β-strand	87-89	3	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	38-39	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phd finger protein 19	A	protein	58	HOMO SAPIENS	Q5T6S3 (AlphaFold model)
Histone H3	B	protein	11	HOMO SAPIENS	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BD3_1 PHD FINGER PROTEIN 19 (chains A)
SKLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGE

Sequence of entity 2 (B), FASTA

>4BD3_2 HISTONE H3 (chains B)
ATGGVKKPHRY

Primary citation

Phf19 Links Methylated Lys36 of Histone H3 to Regulation of Polycomb Activity. Ballare, C., Lange, M., Lapinaite, A. et al. Nat Struct Mol Biol (2012) 19:1257. DOI 10.1038/NSMB.2434 · PubMed

Other PDB entries of the same protein (UniProt Q5T6S3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WAU 1.75 Å, Complex structure of PHF19
9XZI 2.69 Å, Crystal Structure of the SUZ12-RBBP4-PHF19-EPOP PRC2.1 Subcomplex
6NQ3 2.89 Å, Crystal Structure of a SUZ12-RBBP4-PHF19-JARID2 Heterotetrameric Complex
2E5Q Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]

Browse structure collections

About this viewer

MolViewer shows 4BD3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.