Crystal structure of the Legionella pneumophila FIC domain-containing effector AnkX protein (inactive H229A mutant) in complex with cytidine-diphosphate-choline. Determined by X-ray diffraction at 2.55 Å resolution. Released 24 Apr 2013.
Explore 4BET in 3D Show helices and sheets RCSB PDB PDBe
4BET contains 74 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-16 | 6 | |
| α-helix | 19-25 | 7 | |
| α-helix | 29-31 | 3 | |
| α-helix | 39-44 | 6 | |
| α-helix | 48-65 | 18 | |
| α-helix | 69-70 | 2 | |
| α-helix | 74-85 | 12 | |
| α-helix | 89-92 | 4 | |
| α-helix | 99-100 | 2 | |
| β-strand | 106-110 | 5 | 1 |
| α-helix | 111-113 | 3 | |
| β-strand | 114 | 1 | 2 |
| α-helix | 116-123 | 8 | |
| α-helix | 126-130 | 5 | |
| β-strand | 134-137 | 4 | 1 |
| β-strand | 138-140 | 3 | 3 |
| β-strand | 145-147 | 3 | 3 |
| α-helix | 157-159 | 3 | |
| α-helix | 160-174 | 15 | |
| β-strand | 179-184 | 6 | 1 |
| α-helix | 190-204 | 15 | |
| α-helix | 211-227 | 17 | |
| α-helix | 235-236 | 2 | |
| α-helix | 237-243 | 7 | |
| α-helix | 245-250 | 6 | |
| α-helix | 253-256 | 4 | |
| β-strand | 266 | 1 | 2 |
| α-helix | 269-291 | 23 | |
| α-helix | 294-296 | 3 | |
| α-helix | 298-300 | 3 | |
| α-helix | 305-314 | 10 | |
| α-helix | 318-324 | 7 | |
| α-helix | 333-344 | 12 | |
| α-helix | 345-347 | 3 | |
| α-helix | 352-359 | 8 | |
| α-helix | 363-369 | 7 | |
| α-helix | 375-378 | 4 | |
| β-strand | 382 | 1 | 4 |
| α-helix | 383 | 1 | |
| β-strand | 384 | 1 | 5 |
| β-strand | 386 | 1 | 5 |
| β-strand | 391 | 1 | 4 |
| α-helix | 395-402 | 8 | |
| α-helix | 405-413 | 9 | |
| α-helix | 428-435 | 8 | |
| α-helix | 438-449 | 12 | |
| α-helix | 454-458 | 5 | |
| α-helix | 468-473 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-16 | 6 | |
| α-helix | 19-25 | 7 | |
| α-helix | 29-31 | 3 | |
| α-helix | 39-44 | 6 | |
| α-helix | 48-65 | 18 | |
| α-helix | 69-70 | 2 | |
| α-helix | 74-85 | 12 | |
| α-helix | 89-92 | 4 | |
| α-helix | 98-100 | 3 | |
| β-strand | 106-110 | 5 | 6 |
| α-helix | 111-113 | 3 | |
| β-strand | 114 | 1 | 7 |
| α-helix | 116-123 | 8 | |
| α-helix | 126-130 | 5 | |
| β-strand | 134-137 | 4 | 6 |
| β-strand | 138-140 | 3 | 8 |
| β-strand | 145-147 | 3 | 8 |
| α-helix | 157-159 | 3 | |
| α-helix | 160-174 | 15 | |
| β-strand | 179-184 | 6 | 6 |
| α-helix | 190-205 | 16 | |
| α-helix | 211-227 | 17 | |
| α-helix | 235-236 | 2 | |
| α-helix | 237-243 | 7 | |
| α-helix | 245-250 | 6 | |
| α-helix | 253-256 | 4 | |
| β-strand | 266 | 1 | 7 |
| α-helix | 269-291 | 23 | |
| α-helix | 294-296 | 3 | |
| α-helix | 298-300 | 3 | |
| α-helix | 305-314 | 10 | |
| α-helix | 318-324 | 7 | |
| α-helix | 333-344 | 12 | |
| α-helix | 345-347 | 3 | |
| α-helix | 352-359 | 8 | |
| α-helix | 363-369 | 7 | |
| α-helix | 375-378 | 4 | |
| β-strand | 382 | 1 | 9 |
| α-helix | 383 | 1 | |
| β-strand | 384 | 1 | 10 |
| β-strand | 386 | 1 | 10 |
| β-strand | 391 | 1 | 9 |
| α-helix | 395-402 | 8 | |
| α-helix | 405-413 | 9 | |
| α-helix | 428-435 | 8 | |
| α-helix | 438-449 | 12 | |
| α-helix | 454-458 | 5 | |
| α-helix | 468-473 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphocholine transferase ankx | A, B | protein | 512 | LEGIONELLA PNEUMOPHILA | Q5ZXN6 (AlphaFold model) |
>4BET_1 PHOSPHOCHOLINE TRANSFERASE ANKX (chains A, B) MSYYHHHHHHLESTSLYKKAGLENLYFQGVKIMPNLPGLYFLQAYPSEEIWRLFVDGRFW SKENGWRGYESREPGCLNAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQ EKNPGELRTDEPVSFGIPAGRASIKGIEEFLSLVFLTEGGAEFGPGKAGPFGPRFDKNYF KNLNPEQIPDLAKQIYFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNKEIKTAETLD EKLKIIVKHIRMYEVLAPFRDANGRTFVNNLLNIPLMQQGLPPATFYEPNVFDLYSAEEL VVVVKEAIFNTVEIIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPSYEKIKHMDFSDLN PEKLHLKTQKCLSSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVG KTPAHLAVISGNMAMLDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQE DAIKVLNIKDNHGKTAFHYAAEFGTPELISAL
| ID | Name | Formula | Copies |
|---|---|---|---|
| CDC | [2-cytidylate-O'-phosphonyloxyl]-ethyl-trimethyl-ammonium | C14 H26 N4 O11 P2 | 2 |
Water and common crystallization additives (SO4, GOL) are not listed.
Structure of the Legionella Effector Ankx Reveals the Mechanism of Phosphocholine Transfer by the Fic Domain. Campanacci, V., Mukherjee, S., Roy, C.R. et al. EMBO J (2013) 32:1469. DOI 10.1038/EMBOJ.2013.82 · PubMed
Other PDB entries of the same protein (UniProt Q5ZXN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4BET directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.