Crystal Structure of the Haemagglutinin from a Transmissible Mutant H5 Influenza Virus. Determined by X-ray diffraction at 2.12 Å resolution. Released 24 Apr 2013.
Explore 4BH2 in 3D Show helices and sheets RCSB PDB PDBe
4BH2 contains 14 α-helices and 51 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-7 | 6 | 1 |
| β-strand | 8 | 1 | 2 |
| β-strand | 15-16 | 2 | 3 |
| β-strand | 24-25 | 2 | 3 |
| β-strand | 26 | 1 | 4 |
| β-strand | 29-31 | 3 | 5 |
| β-strand | 33-34 | 2 | 6 |
| β-strand | 41-44 | 4 | 7 |
| β-strand | 47 | 1 | 7 |
| α-helix | 48-49 | 2 | |
| β-strand | 50-51 | 2 | 8 |
| β-strand | 55 | 1 | 9 |
| α-helix | 57-62 | 6 | |
| α-helix | 68-69 | 2 | |
| β-strand | 76 | 1 | 10 |
| β-strand | 79-81 | 3 | 8 |
| β-strand | 87 | 1 | 9 |
| β-strand | 93-95 | 3 | 11 |
| α-helix | 98-104 | 7 | |
| β-strand | 108 | 1 | 10 |
| β-strand | 110-115 | 6 | 11 |
| α-helix | 119-121 | 3 | |
| β-strand | 126 | 1 | 12 |
| β-strand | 132-137 | 6 | 13 |
| β-strand | 140-142 | 3 | 13 |
| β-strand | 147-149 | 3 | 11 |
| β-strand | 151 | 1 | 12 |
| β-strand | 153 | 1 | 14 |
| β-strand | 156 | 1 | 14 |
| α-helix | 158-159 | 2 | |
| β-strand | 160-165 | 6 | 15 |
| β-strand | 171-180 | 10 | 11 |
| α-helix | 184-191 | 8 | |
| β-strand | 198-201 | 4 | 15 |
| β-strand | 206-209 | 4 | 15 |
| α-helix | 211-213 | 3 | |
| β-strand | 219 | 1 | 16 |
| β-strand | 222 | 1 | 16 |
| β-strand | 225-233 | 9 | 11 |
| β-strand | 238-243 | 6 | 15 |
| β-strand | 247-250 | 4 | 11 |
| β-strand | 252-257 | 6 | 11 |
| β-strand | 264-266 | 3 | 8 |
| β-strand | 271-276 | 6 | 7 |
| β-strand | 278-280 | 3 | 17 |
| β-strand | 283-285 | 3 | 17 |
| β-strand | 291-292 | 2 | 6 |
| β-strand | 299-301 | 3 | 17 |
| α-helix | 303 | 1 | |
| β-strand | 304-305 | 2 | 6 |
| β-strand | 312-314 | 3 | 5 |
| β-strand | 318 | 1 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 18 |
| β-strand | 10 | 1 | 18 |
| β-strand | 14 | 1 | 2 |
| β-strand | 22-28 | 7 | 1 |
| β-strand | 31-36 | 6 | 1 |
| α-helix | 38-57 | 20 | |
| β-strand | 63-65 | 3 | 17 |
| α-helix | 75-126 | 52 | |
| α-helix | 127-129 | 3 | |
| β-strand | 130-132 | 3 | 1 |
| β-strand | 137-140 | 4 | 1 |
| α-helix | 146-154 | 9 | |
| α-helix | 159-166 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hemagglutinin | A | protein | 328 | INFLUENZA VIRUS | Q5EP31 |
| Hemagglutinin | B | protein | 167 | INFLUENZA VIRUS | Q5EP31 |
>4BH2_1 HEMAGGLUTININ (chains A) DPDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKKHNGKLCDLDGVKPLILRDCSVA GWLLGNPMCDEFINVPEWSYIVEKANPVNDLCYPGDFNDYEELKHLLSRINHFEKIQIIP KSSWSSHEASLGVSSACPYQGKSSFFRNVVWLIKKDSTYPTIKRSYNNTNQEDLLVLWGI HHPNDAAEQTKLYQNPTTYISVGTSTLNQRLVPRIATRSKVKGLSGRMEFFWTILKPNDA INFESNGNFIAPEYAYKIVKKGDSTIMKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLT IGECPKYVKSNRLVLAIGLRNSPQRETR
>4BH2_2 HEMAGGLUTININ (chains B) GLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMN TQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYD KVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYSEEAR
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Water and common crystallization additives (EPE) are not listed.
Receptor Binding by a Ferret-Transmissible H5 Avian Influenza Virus. Xiong, X., Coombs, P.J., R Martin, S. et al. Nature (2013) 497:392. DOI 10.1038/NATURE12144 · PubMed
Other PDB entries of the same protein (UniProt Q5EP31), best resolution first:
MolViewer shows 4BH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.