4BN2: Kinesin-like protein KIF15

The crystal structure of kinesin-like protein KIF15. Determined by X-ray diffraction at 2.69 Å resolution. Released 15 Jan 2014.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 7,582
Mol. weight: 119.48 kDa
Ligands: ADP, MG
Released: 15 Jan 2014

Explore 4BN2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BN2 contains 39 α-helices and 50 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	1
α-helix	13	1
β-strand	14-19	6	2
α-helix	20-23	4
β-strand	37-41	5	3
β-strand	44-47	4	3
β-strand	54-57	4	3
β-strand	60-62	3	2
α-helix	68-84	17
β-strand	89-94	6	2
α-helix	101-105	5
α-helix	121-136	16
β-strand	144-156	13	2
β-strand	160-162	3	2
β-strand	172-175	4	4
β-strand	181-184	4	4
β-strand	189-190	2	2
α-helix	194-212	19
β-strand	222-236	15	2
β-strand	239-251	13	2
α-helix	252-254	3
α-helix	256	1
α-helix	276-292	17
α-helix	301-303	3
α-helix	305-309	5
α-helix	311-313	3
β-strand	319-326	8	2
α-helix	330-332	3
α-helix	333-346	14
β-strand	350-351	2	1
β-strand	359-360	2	2

Chain B: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	5
β-strand	14-19	6	6
α-helix	20-23	4
β-strand	37-41	5	7
β-strand	44-47	4	7
β-strand	54-57	4	7
β-strand	60-62	3	6
α-helix	68-71	4
α-helix	72-76	5
α-helix	77-84	8
β-strand	89-94	6	6
α-helix	101-105	5
α-helix	116-118	3
α-helix	121-136	16
β-strand	144-156	13	6
β-strand	160-162	3	6
β-strand	172-175	4	8
β-strand	181-184	4	8
β-strand	189-190	2	6
α-helix	194-212	19
β-strand	222-236	15	6
β-strand	239-251	13	6
α-helix	252-254	3
α-helix	276-292	17
α-helix	301-303	3
α-helix	305-309	5
α-helix	311-313	3
β-strand	319-326	8	6
α-helix	330-332	3
α-helix	333-346	14
β-strand	350-351	2	5
β-strand	359-360	2	6

Chain C: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	11-12	2	9
β-strand	14-19	6	10
α-helix	20-23	4
β-strand	37-41	5	11
β-strand	44-47	4	11
β-strand	54-57	4	11
β-strand	60-62	3	10
α-helix	68-84	17
β-strand	89-95	7	10
α-helix	101-105	5
α-helix	121-136	16
β-strand	146-156	11	10
β-strand	160-162	3	10
β-strand	172-175	4	12
β-strand	181-184	4	12
β-strand	189-191	3	10
α-helix	194-212	19
β-strand	222-232	11	10
β-strand	243-251	9	10
α-helix	252-254	3
α-helix	276-292	17
α-helix	305-309	5
β-strand	319-326	8	10
α-helix	330-332	3
α-helix	333-346	14
β-strand	350-351	2	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF15	A, B, C	protein	361	HOMO SAPIENS	Q9NS87 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4BN2_1 KINESIN-LIKE PROTEIN KIF15 (chains A, B, C)
GAMGQPSNEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLRLHSNPEPKTFTFDH
VADVDTTQESVFATVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMMGPSESDNFSHNLRG
VIPRSFEYLFSLIDREKEKAGAGKSFLCKCSFIEIYNEQIYDLLDSASAGLYLREHIKKG
VFVVGAVEQVVTSAAEAYQVLSGGWRNRRVASTSMNRESSRSHAVFTITIESMEKSNEIV
NIRTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVITALVDVGNGKQRHVC
YRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGETLSTLNFAQRAKLIKNKAVVNEDTQ
G

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	3
MG	Magnesium ion	Mg	3

Primary citation

The Crystal Structure and Biochemical Characterization of Kif15: A Bifunctional Molecular Motor Involved in Bipolar Spindle Formation and Neuronal Development. Klejnot, M., Falnikar, A., Ulaganathan, V. et al. Acta Crystallogr D Biol Crystallogr (2014) 70:123. DOI 10.1107/S1399004713028721 · PubMed

Other PDB entries of the same protein (UniProt Q9NS87 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6ZPI 4.5 Å, Microtubule complexed with Kif15 motor domain. Symmetrised asymmetric unit
7RYP 4.8 Å, Cryo-EM structure of KIFBP:KIF15
6ZPH 6.9 Å, Kinesin binding protein complexed with Kif15 motor domain

Browse structure collections

About this viewer

MolViewer shows 4BN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.