4BSJ: VEGFR-3 extracellular domains D4-5

Crystal structure of VEGFR-3 extracellular domains D4-5. Determined by X-ray diffraction at 2.5 Å resolution. Released 31 Jul 2013.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,722
Mol. weight: 26.96 kDa
Ligands: NAG
Released: 31 Jul 2013

Explore 4BSJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BSJ contains 4 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	332-337	6	1
β-strand	342-346	5	2
β-strand	350-355	6	3
β-strand	356-361	6	1
α-helix	363-364	2
β-strand	365-370	6	2
β-strand	373-374	2	2
β-strand	383-388	6	3
α-helix	391-393	3
β-strand	395-403	9	2
β-strand	408-419	12	2
β-strand	420-424	5	4
α-helix	425-428	4
β-strand	435-436	2	5
β-strand	441-450	10	4
α-helix	452-453	2
β-strand	457-462	6	6
β-strand	490-491	2	6
β-strand	501-511	11	4
β-strand	514-523	10	4
β-strand	530-538	9	6
β-strand	541-549	9	6
β-strand	551-552	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vascular endothelial growth factor receptor 3	A	protein	232	HOMO SAPIENS	P35916 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BSJ_1 VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 3 (chains A)
DHNPFISVEWLKGPILEATAGDELVKLPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLK
EVTEASTGTYTLALWNSAAGLRRNISLELVVNVPPQIHEKEASSPSIYSRHSRQALTCTA
YGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWRAVTTQDAVNPIESLDTW
TEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structural and Mechanistic Insights Into Vegfr-3 Ligand Binding and Activation. Leppanen, V.-M., Tvorogov, D., Kisko, K. et al. Proc Natl Acad Sci U S A (2013) 110:12960. DOI 10.1073/PNAS.1301415110 · PubMed

Other PDB entries of the same protein (UniProt P35916 (AlphaFold model), which also has an AlphaFold model), best resolution first:

21EI 3.3 Å, Structural and Functional Insights into VEGFR-3-Mediated Lymphangiogenesis : Unraveling…
21ES 3.3 Å, Structural and Functional Insights into VEGFR-3-Mediated Lymphangiogenesis : Unraveling…
4BSK 4.2 Å, Crystal structure of VEGF-C in complex with VEGFR-3 domains D1-2

Browse structure collections

About this viewer

MolViewer shows 4BSJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.