4BSN: Exportin-1

Crystal structure of the Nuclear Export Receptor CRM1 (exportin-1) lacking the C-terminal helical extension at 4.1A. Determined by X-ray diffraction at 4.1 Å resolution. Released 31 Jul 2013.

Method: X-ray diffraction
Resolution: 4.1 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 5,481
Mol. weight: 118.86 kDa
Released: 31 Jul 2013

Explore 4BSN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BSN contains 42 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 42 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-18	15
α-helix	24-36	13
α-helix	38-52	15
α-helix	58-64	7
α-helix	73-90	18
α-helix	96-114	19
α-helix	118-121	4
α-helix	125-141	17
α-helix	149-156	8
α-helix	161-174	14
α-helix	188-215	28
α-helix	219-231	13
α-helix	238-240	3
α-helix	246-252	7
α-helix	261-272	12
α-helix	275-276	2
α-helix	281-297	17
α-helix	304-309	6
α-helix	313-339	27
α-helix	343-357	15
α-helix	363-383	21
α-helix	404-423	20
β-strand	433-434	2	1
β-strand	440-441	2	1
α-helix	449-467	19
α-helix	469-485	17
α-helix	491-504	14
α-helix	510-530	21
α-helix	533-549	17
α-helix	552-555	4
α-helix	559-572	14
α-helix	580-594	15
α-helix	596-600	5
α-helix	610-621	12
α-helix	627-641	15
α-helix	648-666	19
α-helix	692-702	11
α-helix	707-710	4
α-helix	714-722	9
α-helix	759-765	7
α-helix	769-771	3
α-helix	772-776	5
α-helix	781-785	5
α-helix	786-789	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Exportin-1	A	protein	1032	HOMO SAPIENS	O14980 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BSN_1 EXPORTIN-1 (chains A)
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSD

Primary citation

Structure of a Truncation Mutant of the Nuclear Export Factor Crm1 Provides Insights Into the Auto-Inhibitory Role of its C-Terminal Helix. Dian, C., Bernaudat, F., Langer, K. et al. Structure (2013) 21:1338. DOI 10.1016/J.STR.2013.06.003 · PubMed

Other PDB entries of the same protein (UniProt O14980 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1W9C 2.3 Å, Proteolytic fragment of CRM1 spanning six C-terminal HEAT repeats
9OGD 2.49 Å, Cryo-EM structure of human exportin-1 conjugated with selinexor and bound to human…
7B51 2.58 Å, Crystal structure of human CRM1 covalently modified by 2-mercaptoethanol at Cys528
9HFL 2.62 Å, Cryo-EM structure of the human snRNA export complex comprising CBC-PHAX-CRM1-RanGTP and…
5DIS 2.85 Å, Crystal structure of a CRM1-RanGTP-SPN1 export complex bound to a 113 amino acid…
3GB8 2.9 Å, Crystal structure of CRM1/Snurportin-1 complex
9B62 2.9 Å, Human RANBP2/RAN(GTP)/RANGAP1-SUMO1/UBC9/CRM1/RAN(GTP) - composite map and model
9OG9 2.93 Å, Cryo-EM structure of human full-length XPO1 (unliganded)
11RM 2.95 Å, Cryo-EM structure of human exportin-1 conjugated with FR-027*
6TVO 3.2 Å, Human CRM1-RanGTP in complex with Leptomycin B
9OGB 3.25 Å, Cryo-EM structure of human exportin-1 conjugated with selinexor and bound to yeast…
9OGE 3.28 Å, Cryo-EM structure of human exportin-1 conjugated with KPT-127 and bound to human…

Browse structure collections

About this viewer

MolViewer shows 4BSN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.