4BSZ: Yeast Ribosomal Protein Rps3

Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1. Determined by X-ray diffraction at 2.84 Å resolution. Released 4 Sept 2013.

Method: X-ray diffraction
Resolution: 2.84 Å
Organism: SACCHAROMYCES CEREVISIAE
Chains: 2
Atoms: 2,629
Mol. weight: 49.57 kDa
Released: 4 Sept 2013

Explore 4BSZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4BSZ contains 21 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	15-28	14
β-strand	34-42	9	1
β-strand	45-52	8	1
α-helix	55-59	5
α-helix	64-77	14
α-helix	79-80	2
β-strand	84-90	7	1
α-helix	94-96	3
α-helix	98-110	13
α-helix	115-128	14
β-strand	134-140	7	2
β-strand	152-158	7	2
α-helix	163-167	5
β-strand	168-176	9	3
β-strand	181-189	9	3
α-helix	192-194	3

Chain B: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	25-30	6
α-helix	31-35	5
α-helix	38-43	6
β-strand	45	1	4
β-strand	52	1	4
α-helix	53-59	7
α-helix	63-76	14
α-helix	79-86	8
α-helix	96-102	7
α-helix	106-110	5
α-helix	111-115	5
α-helix	130-136	7
α-helix	140-149	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
40S ribosomal protein S3	A	protein	244	SACCHAROMYCES CEREVISIAE	P05750 (AlphaFold model)
Ankyrin repeat-containing protein YAR1	B	protein	202	SACCHAROMYCES CEREVISIAE	P46683 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4BSZ_1 40S RIBOSOMAL PROTEIN S3 (chains A)
MADPMVALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQ
DVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAESMKFKLLNGLAIR
RAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPVNDFIDTATRHVL
MRQGVLGIKVKIMRDPAKSRTGPKALPDAVTIIEPKEEEPILAPSVKDYRPAEETEAQAE
PVEA

Sequence of entity 2 (B), FASTA

>4BSZ_2 ANKYRIN REPEAT-CONTAINING PROTEIN YAR1 (chains B)
DLMGLHSEPLDQEDQDTIILDARAGDLDSLKDIFTTLVSPELLSTCKESESDSTALHMAA
ANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEA
DPFIRNKFGHDAIFEAENSGKEEVETYFLKKYDVEPEDDEEDTQTEGKNSVQITKGTEIE
QVTKEATEALREETEKLNINKD

Primary citation

Crystal Structure of the Yeast Ribosomal Protein Rps3 in Complex with its Chaperone Yar1. Holzer, S., Ban, N., Klinge, S. J Mol Biol (2013) 425:4154. DOI 10.1016/J.JMB.2013.08.022 · PubMed

Other PDB entries of the same protein (UniProt P05750 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PN5 1.75 Å, Composite map of hypomethylated 80S ribosome treated with hygromycin B
8CCS 1.97 Å, 80S S. cerevisiae ribosome with ligands in hybrid-1 pre-translocation (PRE-H1) complex
8CDR 2.04 Å, Translocation intermediate 2 (TI-2) of 80S S. cerevisiae ribosome with ligands and eEF2…
8T2Y 2.2 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, and A-site tRNA,…
8ZHC 2.3 Å, pre-frameshift complex of yeast 80S ribosome with eRF1 and mRNA of WNV
9DP7 2.38 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
7ZW0 2.4 Å, FAP-80S Complex - Rotated state
8BN3 2.4 Å, Yeast 80S, ES7s delta, eIF5A, Stm1 containing
8T2Z 2.4 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, and A-site tRNA,…
8T2X 2.46 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, A-site tRNA, messenger…
9DOV 2.49 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
7ZUX 2.5 Å, Collided ribosome in a disome unit from S. cerevisiae

Browse structure collections

About this viewer

MolViewer shows 4BSZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.