4C4P: Wild-Type Rab11 Complexed to FIP2

Crystal Structure of Wild-Type Rab11 Complexed to FIP2. Determined by X-ray diffraction at 2.0 Å resolution. Released 18 Sept 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,070
Mol. weight: 32.35 kDa
Ligands: MG, GNP
Released: 18 Sept 2013

Explore 4C4P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4C4P contains 10 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-17	8	1
α-helix	24-33	10
α-helix	42-44	3
β-strand	46-55	10	1
β-strand	58-67	10	1
α-helix	77-81	5
β-strand	84-92	9	1
α-helix	96-100	5
α-helix	102-112	11
β-strand	118-124	7	1
α-helix	129-131	3
α-helix	136-145	10
β-strand	149-152	4	1
α-helix	161-170	10

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	453-491	39
α-helix	493-496	4
β-strand	497-498	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein rab-11A	A	protein	173	HOMO SAPIENS	P62491 (AlphaFold model)
RAB11 family-interacting protein 2	B	protein	107	HOMO SAPIENS	Q7L804 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4C4P_1 RAS-RELATED PROTEIN RAB-11A (chains A)
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIY

Sequence of entity 2 (B), FASTA

>4C4P_2 RAB11 FAMILY-INTERACTING PROTEIN 2 (chains B)
GAMAAKFRASNIMPSSSFHMSPTSNEDLRKIPDSNPFDATAGYRSLTYEEVLQELVKHKE
LLRRKDTHIRELEDYIDNLLVRVMEETPSILRVPYEPSRKAGKFSNS

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1

Primary citation

Structural and Functional Analysis of Fip2 Binding to the Endosome-Localised Rab25 Gtpase. Lall, P., Horgan, C.P., Oda, S. et al. Biochim Biophys Acta (2013) 1834:2679. DOI 10.1016/J.BBAPAP.2013.09.005 · PubMed

Other PDB entries of the same protein (UniProt P62491 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1OIX 1.7 Å, X-ray structure of the small G protein Rab11a in complex with GDP and Pi
2D7C 1.75 Å, Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
2HV8 1.86 Å, Crystal structure of GTP-bound Rab11 in complex with FIP3
1OIV 1.98 Å, X-ray structure of the small G protein Rab11a in complex with GDP
1YZK 2.0 Å, GppNHp bound Rab11 GTPase
1OIW 2.05 Å, X-ray structure of the small G protein Rab11a in complex with GTPgammaS
5JCZ 2.06 Å, Rab11 bound to MyoVa-GTD
6IY1 2.11 Å, Structure of human Ras-related protein Rab11
4LX0 2.19 Å, Crystal structure of Myo5b globular tail domain in complex with active Rab11a
5EZ5 2.4 Å, Crystal structure of active Rab11A (S20V) in complex with GTP
2GZD 2.44 Å, Crystal Structure of Rab11 in Complex with Rab11-FIP2
2GZH 2.47 Å, Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2

Browse structure collections

About this viewer

MolViewer shows 4C4P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.