mouse ZNRF3 ectodomain crystal form V, disulfide-bridged S90C variant. Determined by X-ray diffraction at 2.1 Å resolution. Released 20 Nov 2013.
Explore 4C8P in 3D Show helices and sheets RCSB PDB PDBe
4C8P contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 55-65 | 11 | 1 |
| α-helix | 70 | 1 | |
| β-strand | 71-82 | 12 | 1 |
| β-strand | 86 | 1 | 2 |
| β-strand | 91-97 | 7 | 1 |
| α-helix | 100-103 | 4 | |
| β-strand | 117-122 | 6 | 1 |
| α-helix | 136-145 | 10 | |
| β-strand | 148-154 | 7 | 1 |
| α-helix | 161-165 | 5 | |
| β-strand | 173 | 1 | 2 |
| β-strand | 177-180 | 4 | 1 |
| α-helix | 182-194 | 13 | |
| β-strand | 199-203 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase ZNRF3 | A | protein | 165 | MUS MUSCULUS | Q5SSZ7 (AlphaFold model) |
>4C8P_1 E3 UBIQUITIN-PROTEIN LIGASE ZNRF3 (chains A) ETGKETAFVEVVLFESSPSGDYTTHTTGLTGRFSRAGAMLCAEGEIVQMHPLGLCNNNDE EDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGS EDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHLGTKHHHHHH
Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin. Zebisch, M., Xu, Y., Krastev, C. et al. Nat Commun (2013) 4:2787. DOI 10.1038/NCOMMS3787 · PubMed
Other PDB entries of the same protein (UniProt Q5SSZ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4C8P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.