4C9B: EIF4AIII-CWC22 complex

Crystal structure of eIF4AIII-CWC22 complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 13 Nov 2013.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,695
Mol. weight: 81.36 kDa
Ligands: PO4
Released: 13 Nov 2013

Explore 4C9B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4C9B contains 42 α-helices and 21 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	23-25	3
β-strand	28-30	3	1
α-helix	40-42	3
α-helix	47-56	10
α-helix	61-62	2
α-helix	65-73	9
β-strand	78-81	4	1
α-helix	88-98	11
β-strand	109-112	4	1
α-helix	116-129	14
β-strand	137-139	3	1
α-helix	143-145	3
α-helix	146-155	10
β-strand	159-162	4	1
α-helix	164-173	10
β-strand	183-186	4	1
α-helix	189-195	7
α-helix	198-206	9
β-strand	213-218	6	1
α-helix	223-232	10
α-helix	236	1
β-strand	237-241	5	1
α-helix	242-243	2
β-strand	246-247	2	2
β-strand	251-259	9	3
α-helix	261-263	3
α-helix	264-274	11
β-strand	279-283	5	3
α-helix	287-299	13
β-strand	304-307	4	3
α-helix	313-325	13
β-strand	330-333	4	3
β-strand	346-351	6	3
α-helix	360-365	6
α-helix	366	1
β-strand	367-368	2	2
α-helix	372-374	3
β-strand	375-382	8	3
α-helix	383-385	3
α-helix	386-396	11
β-strand	401-402	2	3
α-helix	403	1
β-strand	404	1	4
α-helix	405-410	6

Chain B: 16 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	127-128	2
β-strand	132	1	4
α-helix	136-140	5
α-helix	150-172	23
α-helix	178-186	9
α-helix	194-207	14
α-helix	209-211	3
α-helix	212-225	14
α-helix	227-247	21
α-helix	250-265	16
β-strand	269	1	5
α-helix	272-283	12
α-helix	287-307	21
α-helix	309-324	16
α-helix	330-344	15
α-helix	362-364	3
β-strand	368	1	5
α-helix	380-383	4
α-helix	391-405	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eukaryotic initiation factor 4A-III	A	protein	411	HOMO SAPIENS	P38919 (AlphaFold model)
Pre-mRNA-splicing factor CWC22 homolog	B	protein	291	HOMO SAPIENS	Q9HCG8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4C9B_1 EUKARYOTIC INITIATION FACTOR 4A-III (chains A)
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEK
PSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAV
QIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRA
IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRIL
VKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNREL
YIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

Sequence of entity 2 (B), FASTA

>4C9B_2 PRE-MRNA-SPLICING FACTOR CWC22 HOMOLOG (chains B)
KKKKDELDPLLTRTGGAYIPPAKLRMMQEQITDKNSLAYQRMSWEALKKSINGLINKVNI
SNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILK
RLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIG
FLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILE
GLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEIL

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal Structure of the Human Eif4Aiii-Cwc22 Complex Shows How a Dead-Box Protein is Inhibited by a Mif4G Domain. Buchwald, G., Schuessler, S., Basquin, C. et al. Proc Natl Acad Sci U S A (2013) 110:E4611. DOI 10.1073/PNAS.1314684110 · PubMed

Other PDB entries of the same protein (UniProt P38919 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J0S 2.21 Å, The crystal structure of the Exon Junction Complex at 2.2 A resolution
2HYI 2.3 Å, Structure of the human exon junction complex with a trapped DEAD-box helicase bound to RNA
3EX7 2.3 Å, The crystal structure of EJC in its transition state
7ZNJ 2.4 Å, Structure of an ALYREF-exon junction complex hexamer
8C6J 2.8 Å, Human spliceosomal PM5 C* complex
9XTT 2.92 Å, Human minor spliceosome branching-completed C complex (after step-I)
2J0U 3.0 Å, The crystal structure of eIF4AIII-Barentsz complex at 3.0 A resolution
6ICZ 3.0 Å, Cryo-EM structure of a human post-catalytic spliceosome (P complex) at 3.0 angstrom
9XU3 3.0 Å, Human minor spliceosome exon-ligation-ready C* complex (prior to step-II)
6YVH 3.19 Å, CWC22-CWC27-EIF4A3 Complex
2J0Q 3.2 Å, The crystal structure of the Exon Junction Complex at 3.2 A resolution
2HXY 3.3 Å, Crystal structure of human apo-eIF4AIII

Browse structure collections

About this viewer

MolViewer shows 4C9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.