Xenopus RNF43 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Nov 2013.
Explore 4C9V in 3D Show helices and sheets RCSB PDB PDBe
4C9V contains 5 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-43 | 8 | 1 |
| β-strand | 57-63 | 7 | 1 |
| β-strand | 67 | 1 | 2 |
| β-strand | 72-78 | 7 | 1 |
| β-strand | 97-102 | 6 | 1 |
| α-helix | 116-125 | 10 | |
| β-strand | 128-134 | 7 | 1 |
| α-helix | 140-143 | 4 | |
| β-strand | 151 | 1 | 2 |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 161-171 | 11 | |
| β-strand | 176-181 | 6 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-47 | 5 | 3 |
| β-strand | 51-55 | 5 | 3 |
| β-strand | 60-66 | 7 | 3 |
| β-strand | 69-75 | 7 | 3 |
| α-helix | 78-79 | 2 | |
| β-strand | 82-86 | 5 | 3 |
| β-strand | 91-95 | 5 | 3 |
| β-strand | 101-106 | 6 | 4 |
| β-strand | 109-113 | 5 | 4 |
| β-strand | 118-120 | 3 | 5 |
| β-strand | 123-125 | 3 | 5 |
| α-helix | 133-135 | 3 | |
| β-strand | 140 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| RNF43 | A | protein | 180 | XENOPUS (SILURANA) TROPICALIS | |
| R-spondin-2 | B | protein | 121 | XENOPUS (SILURANA) TROPICALIS | Q5M7L6 (AlphaFold model) |
>4C9V_1 RNF43 (chains A) ETGTTEREMDVKALIRVTPLQAEESGGVGQGNLTLEGLFARVAEISPAEGRLLQFHPLSL CNTSEDDQTKPGFISIVKLETPDRDTQPCLSLANKARLAGERGAHAVLFDITNDRGALQQ LQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEVQEQPKWLHHDGTHHHHHHHHHH
>4C9V_2 R-SPONDIN-2 (chains B) ETGGTNPICKGCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDMN RCSRCRIENCDSCFSRDFCIKCKSGFYSHKGQCFEECPEGFAPLDDTMVCVDGTKHHHHH H
Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin. Zebisch, M., Xu, Y., Krastev, C. et al. Nat Commun (2013) 4:2787. DOI 10.1038/NCOMMS3787 · PubMed
Other PDB entries of the same protein (UniProt Q5M7L6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4C9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.