4C9V: Xenopus RNF43 ectodomain

Xenopus RNF43 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2. Determined by X-ray diffraction at 2.7 Å resolution. Released 20 Nov 2013.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: XENOPUS (SILURANA) TROPICALIS
Chains: 2
Atoms: 1,679
Mol. weight: 33.77 kDa
Released: 20 Nov 2013

Explore 4C9V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4C9V contains 5 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	36-43	8	1
β-strand	57-63	7	1
β-strand	67	1	2
β-strand	72-78	7	1
β-strand	97-102	6	1
α-helix	116-125	10
β-strand	128-134	7	1
α-helix	140-143	4
β-strand	151	1	2
β-strand	155-158	4	1
α-helix	161-171	11
β-strand	176-181	6	1

Chain B: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	43-47	5	3
β-strand	51-55	5	3
β-strand	60-66	7	3
β-strand	69-75	7	3
α-helix	78-79	2
β-strand	82-86	5	3
β-strand	91-95	5	3
β-strand	101-106	6	4
β-strand	109-113	5	4
β-strand	118-120	3	5
β-strand	123-125	3	5
α-helix	133-135	3
β-strand	140	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNF43	A	protein	180	XENOPUS (SILURANA) TROPICALIS
R-spondin-2	B	protein	121	XENOPUS (SILURANA) TROPICALIS	Q5M7L6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4C9V_1 RNF43 (chains A)
ETGTTEREMDVKALIRVTPLQAEESGGVGQGNLTLEGLFARVAEISPAEGRLLQFHPLSL
CNTSEDDQTKPGFISIVKLETPDRDTQPCLSLANKARLAGERGAHAVLFDITNDRGALQQ
LQQPAGINQPVVLIWGPDAEKLMDVVNKNKEALVKIEVQEQPKWLHHDGTHHHHHHHHHH

Sequence of entity 2 (B), FASTA

>4C9V_2 R-SPONDIN-2 (chains B)
ETGGTNPICKGCLSCSKDNGCLRCQPKLFFYLRREGMRQYGECLQSCPPGYYGVRGPDMN
RCSRCRIENCDSCFSRDFCIKCKSGFYSHKGQCFEECPEGFAPLDDTMVCVDGTKHHHHH
H

Primary citation

Structural and Molecular Basis of Znrf3/Rnf43 Transmembrane Ubiquitin Ligase Inhibition by the Wnt Agonist R-Spondin. Zebisch, M., Xu, Y., Krastev, C. et al. Nat Commun (2013) 4:2787. DOI 10.1038/NCOMMS3787 · PubMed

Other PDB entries of the same protein (UniProt Q5M7L6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4C9R 2.1 Å, Xenopus ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 crystal form I
4C8V 2.2 Å, Xenopus RSPO2 Fu1-Fu2 crystal form I
4C9A 2.4 Å, Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form I
4C9E 3.0 Å, Mouse ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 (Seleno Met) crystal form II
4C9U 3.0 Å, Xenopus ZNRF3 ectodomain in complex with Xenopus RSPO2 Fu1-Fu2 crystal form II
4C8W 3.1 Å, Xenopus RSPO2 Fu1-Fu2 crystal form II

Browse structure collections

About this viewer

MolViewer shows 4C9V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.