4CDO: PQBP1

Crystal structure of PQBP1 bound to spliceosomal U5-15kD. Determined by X-ray diffraction at 2.5 Å resolution. Released 30 Apr 2014.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,461
Mol. weight: 42.66 kDa
Released: 30 Apr 2014

Explore 4CDO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CDO contains 9 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-8	2	1
α-helix	11-19	9
β-strand	25-31	7	1
α-helix	36-48	13
β-strand	56-62	7	1
β-strand	80-85	6	1
β-strand	88-89	2	1
β-strand	91-93	3	2
β-strand	102	1	1
α-helix	109-124	16
β-strand	129-131	3	2
α-helix	248-258	11

Chain C: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	3
α-helix	11-19	9
β-strand	25-31	7	3
α-helix	36-48	13
β-strand	56-62	7	3
β-strand	80-85	6	3
β-strand	88-89	2	3
β-strand	91-93	3	4
β-strand	102	1	3
α-helix	109-124	16
β-strand	129-131	3	4
α-helix	248-258	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin-like protein 4A, polyglutamine-binding protein	A, C	protein	185	HOMO SAPIENS	O60828 (AlphaFold model), P83876 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4CDO_1 THIOREDOXIN-LIKE PROTEIN 4A, POLYGLUTAMINE-BINDING PROTEIN (chains A, C)
MAHHHHHHMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNF
AVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDI
IETVYRGARKGRGLVVSPKDYSKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASR
TKQQD

Primary citation

Mutations in the Pqbp1 Gene Prevent its Interaction with the Spliceosomal Protein U5-15Kd. Mizuguchi, M., Obita, T., Serita, T. et al. Nat Commun (2014) 5:3822. DOI 10.1038/NCOMMS4822 · PubMed

Other PDB entries of the same protein (UniProt O60828 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4BWQ 2.1 Å, Crystal structure of U5-15kD in a complex with PQBP1
4BWS 2.5 Å, Crystal structure of the heterotrimer of PQBP1, U5-15kD and U5-52kD.

Browse structure collections

About this viewer

MolViewer shows 4CDO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.