4CFR: Ca-bound S100A4 C3S, C81S, C86S and F45W mutant

Ca-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with non- muscle myosin IIA. Determined by X-ray diffraction at 1.4 Å resolution. Released 7 May 2014.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 2,220
Mol. weight: 29.56 kDa
Ligands: CA
Released: 7 May 2014

Explore 4CFR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CFR contains 12 α-helices and 6 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17
β-strand	29	1	1
α-helix	31-41	11
α-helix	43-45	3
α-helix	52-62	11
β-strand	70	1	1
α-helix	72-92	21

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	4-20	17
β-strand	29	1	2
α-helix	31-41	11
α-helix	43-45	3
β-strand	46	1	3
α-helix	52-62	11
β-strand	70	1	2
α-helix	72-91	20

Chain Q: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1899-1903	5
α-helix	1907-1922	16
β-strand	1929	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein S100-A4	A, B	protein	104	HOMO SAPIENS	P26447 (AlphaFold model)
Myosin-9	Q	protein	45	HOMO SAPIENS	P35579 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CFR_1 PROTEIN S100-A4 (chains A, B)
GSHMASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSWLGKRTDEAAFQK
LMSNLDSNRDNEVDFQEYCVFLSSIAMMSNEFFEGFPDKQPRKK

Sequence of entity 2 (Q), FASTA

>4CFR_2 MYOSIN-9 (chains Q)
YRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation. Duelli, A., Kiss, B., Lundholm, I. et al. PLoS One (2014) 9:97654. DOI 10.1371/JOURNAL.PONE.0097654 · PubMed

Other PDB entries of the same protein (UniProt P26447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CFQ 1.37 Å, Ca-bound truncated (delta13C) and C3S, C81S and C86S mutated S100A4 complexed with…
3C1V 1.5 Å, The 1.5 A Crystal structure of Ca2+-bound S100A4
4ETO 1.54 Å, Structure of S100A4 in complex with non-muscle myosin-IIA peptide
2Q91 1.63 Å, Structure of the Ca2+-Bound Activated Form of the S100A4 Metastasis Factor
27UH 1.82 Å, Crystal structure of a de novo-designed VHH targeting S100A4
7PSQ 1.91 Å, Crystal structure of S100A4 labeled with NU074381b.
3ZWH 1.94 Å, Ca2+-bound S100A4 C3S, C81S, C86S and F45W mutant complexed with myosin IIA
3CGA 2.03 Å, Crystal structure of metastasis-associated protein S100A4 in the active, calcium-bound…
5LPU 2.1 Å, Crystal structure of Annexin A2 complexed with S100A4
4HSZ 2.25 Å, Structure of truncated (delta8C) S100A4
3KO0 2.3 Å, Structure of the tfp-ca2+-bound activated form of the s100a4 Metastasis factor
7PSP 2.61 Å, Crystal structure of S100A4 labeled with NU000846b.

Browse structure collections

About this viewer

MolViewer shows 4CFR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.