4CRI: 53BP1 tandem tudor domains

Crystal Structure of 53BP1 tandem tudor domains in complex with methylated K810 Rb peptide. Determined by X-ray diffraction at 2.35 Å resolution. Released 6 Aug 2014.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 1,991
Mol. weight: 42.78 kDa
Released: 6 Aug 2014

Explore 4CRI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4CRI contains 10 α-helices and 26 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	1490-1494	5	1
β-strand	1501-1511	11	1
β-strand	1514-1519	6	1
β-strand	1524-1528	5	1
α-helix	1529-1531	3
β-strand	1532-1533	2	1
α-helix	1538-1539	2
β-strand	1543-1546	4	2
β-strand	1548	1	3
β-strand	1554-1564	11	2
β-strand	1567-1574	8	2
β-strand	1577-1582	6	2
α-helix	1583-1585	3
β-strand	1586-1587	2	2
β-strand	1588	1	1
α-helix	1590-1595	6
α-helix	1597-1600	4
β-strand	1601	1	1

Chain B: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	1490-1495	6	1
β-strand	1500-1511	12	1
β-strand	1514-1519	6	1
β-strand	1524-1528	5	1
α-helix	1529-1531	3
β-strand	1532-1533	2	1
α-helix	1538-1539	2
β-strand	1543-1546	4	4
β-strand	1554-1564	11	4
β-strand	1567-1574	8	4
β-strand	1577-1582	6	4
α-helix	1583-1585	3
β-strand	1586-1587	2	4
β-strand	1588	1	1
α-helix	1590-1595	6
α-helix	1597-1600	4
β-strand	1601	1	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	806	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor suppressor P53-binding protein 1	A, B	protein	176	HOMO SAPIENS	Q12888 (AlphaFold model)
RB1 protein	C, D	protein	17	HOMO SAPIENS	P06400 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4CRI_1 TUMOR SUPPRESSOR P53-BINDING PROTEIN 1 (chains A, B)
RSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLL
FDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQR
KWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNVS

Sequence of entity 2 (C, D), FASTA

>4CRI_2 RB1 PROTEIN (chains C, D)
GNIYISPLKSPYKISEC

Primary citation

Lysine Methylation-Dependent Binding of 53BP1 to the Prb Tumor Suppressor. Carr, S.M., Munro, S., Zalmas, L. et al. Proc Natl Acad Sci U S A (2014) 111:11341. DOI 10.1073/PNAS.1403737111 · PubMed

Other PDB entries of the same protein (UniProt Q12888 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SVI 1.15 Å, Ubiquitin variant i53:Mutant L67H with 53BP1 Tudor domain
8SVH 1.16 Å, Ubiquitin variant i53 mutant L67R bound to 53BP1 Tudor Domain
8SVG 1.21 Å, Ubiquitin variant i53 in complex with 53BP1 Tudor domain
2G3R 1.25 Å, Crystal Structure of 53BP1 tandem tudor domains at 1.2 A resolution
6VA5 1.28 Å, Tudor Domain of Tumor suppressor p53BP1 with MFP-4184
6VIP 1.36 Å, Tudor domain of tumor suppressor P53BP1 with mfp-6008
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
3LGF 1.5 Å, Crystal structure of the 53BP1 tandem tudor domain in complex with p53K370me2
4RG2 1.5 Å, Tudor Domain of Tumor suppressor p53BP1 with small molecule ligand
8SVJ 1.5 Å, Ubiquitin variant i53: mutant VHH with 53BP1 Tudor domain
8F0W 1.52 Å, Tudor Domain of Tumor suppressor p53BP1 with MFP-5956
3LGL 1.6 Å, Crystal structure of the 53BP1 tandem tudor domain in complex with p53K382me2

Browse structure collections

About this viewer

MolViewer shows 4CRI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.