Crystal structure of the KANSL1-WDR5 complex. Determined by X-ray diffraction at 1.5 Å resolution. Released 14 May 2014.
Explore 4CY1 in 3D Show helices and sheets RCSB PDB PDBe
4CY1 contains 4 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-41 | 6 | 1 |
| β-strand | 48-53 | 6 | 2 |
| β-strand | 59-64 | 6 | 2 |
| β-strand | 68-73 | 6 | 2 |
| β-strand | 79-84 | 6 | 2 |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 101-106 | 6 | 3 |
| β-strand | 111-115 | 5 | 3 |
| β-strand | 120-125 | 6 | 3 |
| β-strand | 132-137 | 6 | 4 |
| β-strand | 143-148 | 6 | 4 |
| β-strand | 153-157 | 5 | 4 |
| β-strand | 163-167 | 5 | 4 |
| β-strand | 174-179 | 6 | 5 |
| β-strand | 185-190 | 6 | 5 |
| β-strand | 195-199 | 5 | 5 |
| β-strand | 205-209 | 5 | 5 |
| α-helix | 215-216 | 2 | |
| β-strand | 217-222 | 6 | 6 |
| β-strand | 229-233 | 5 | 6 |
| β-strand | 237-242 | 6 | 6 |
| β-strand | 247-252 | 6 | 6 |
| β-strand | 264-267 | 4 | 7 |
| β-strand | 273-276 | 4 | 7 |
| β-strand | 283-287 | 5 | 7 |
| β-strand | 293-297 | 5 | 7 |
| β-strand | 304-309 | 6 | 1 |
| β-strand | 315-320 | 6 | 1 |
| β-strand | 327-331 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-41 | 6 | 8 |
| β-strand | 48-53 | 6 | 9 |
| β-strand | 59-64 | 6 | 9 |
| β-strand | 68-73 | 6 | 9 |
| β-strand | 79-84 | 6 | 9 |
| β-strand | 90-95 | 6 | 10 |
| β-strand | 101-106 | 6 | 10 |
| β-strand | 111-115 | 5 | 10 |
| β-strand | 121-125 | 5 | 10 |
| β-strand | 132-137 | 6 | 11 |
| β-strand | 143-148 | 6 | 11 |
| β-strand | 153-157 | 5 | 11 |
| β-strand | 163-167 | 5 | 11 |
| β-strand | 174-179 | 6 | 12 |
| β-strand | 185-190 | 6 | 12 |
| β-strand | 195-199 | 5 | 12 |
| β-strand | 205-209 | 5 | 12 |
| α-helix | 215-216 | 2 | |
| β-strand | 217-222 | 6 | 13 |
| β-strand | 228-233 | 6 | 13 |
| β-strand | 237-242 | 6 | 13 |
| β-strand | 247-252 | 6 | 13 |
| β-strand | 264-267 | 4 | 14 |
| β-strand | 273-276 | 4 | 14 |
| β-strand | 283-287 | 5 | 14 |
| β-strand | 293-297 | 5 | 14 |
| β-strand | 304-309 | 6 | 8 |
| β-strand | 315-320 | 6 | 8 |
| β-strand | 327-331 | 5 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 591-593 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Wd repeat-containing protein 5 | A, B | protein | 316 | HOMO SAPIENS | P61964 (AlphaFold model) |
| KAT8 regulatory nsl complex subunit 1 | C, D | protein | 15 | HOMO SAPIENS | Q7Z3B3 (AlphaFold model) |
>4CY1_1 WD REPEAT-CONTAINING PROTEIN 5 (chains A, B) MGATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFE KTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDT ASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAA LENDKTIKLWKSDCGA
>4CY1_2 KAT8 REGULATORY NSL COMPLEX SUBUNIT 1 (chains C, D) DGTCVAARTRPVLSY
Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex. Dias, J., Van Nguyen, N., Georgiev, P. et al. Genes Dev (2014) 28:929. DOI 10.1101/GAD.240200.114 · PubMed
Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4CY1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.