4D07: Dynein light chain 2, cytoplasmic

DYNLL2 dynein light chain binds to an extended, unstructured linear motif of myosin 5a tail. Determined by X-ray diffraction at 1.85 Å resolution. Released 22 Oct 2014.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,009
Mol. weight: 13.95 kDa
Ligands: CO
Released: 22 Oct 2014

Explore 4D07 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D07 contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	4-5	2
β-strand	6-13	8	1
α-helix	15-31	17
α-helix	35-50	16
β-strand	54-59	6	1
β-strand	63-67	5	2
β-strand	72-78	7	1
β-strand	81-87	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-10	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynein light chain 2, cytoplasmic	A	protein	92	HOMO SAPIENS	Q96FJ2 (AlphaFold model)
Myosin va variant	B	protein	27	HOMO SAPIENS	Q9Y4I1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4D07_1 DYNEIN LIGHT CHAIN 2, CYTOPLASMIC (chains A)
GSHMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCI
VGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Sequence of entity 2 (B), FASTA

>4D07_2 MYOSIN VA VARIANT (chains B)
GSHMSQKEAIQPKDDKNTMTDSTILLE

Ligands and cofactors

ID	Name	Formula	Copies
CO	Cobalt (II) ion	Co	1

Water and common crystallization additives (SO4, TRS) are not listed.

Primary citation

Dynll2 Dynein Light Chain Binds to an Extended Linear Motif of Myosin 5A Tail that Has Structural Plasticity. Bodor, A., Radnai, L., Hetenyi, C. et al. Biochemistry (2014) 53:7107. DOI 10.1021/BI500574Z · PubMed

Other PDB entries of the same protein (UniProt Q96FJ2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XQQ 1.31 Å, Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide…
7CNU 2.0 Å, Crystal structure of DLC2 in complex with BMF peptide
3P8M 2.9 Å, Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized…

Browse structure collections

About this viewer

MolViewer shows 4D07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.