4D0L: Phosphatidylinositol 4-kinase beta
Phosphatidylinositol 4-kinase III beta-PIK93 in a complex with Rab11a- GTP gammaS. Determined by X-ray diffraction at 2.94 Å resolution. Released 28 May 2014.
- Method
- X-ray diffraction
- Resolution
- 2.94 Å
- Organism
- HOMO SAPIENS
- Chains
- 6
- Atoms
- 15,864
- Mol. weight
- 270.72 kDa
- Ligands
- 093, GSP, MG
- Released
- 28 May 2014
Explore 4D0L in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4D0L contains 110 α-helices and 51 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 27 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 129-134 | 6 | |
| α-helix | 141-150 | 10 | |
| α-helix | 154-163 | 10 | |
| α-helix | 164-166 | 3 | |
| α-helix | 169-173 | 5 | |
| α-helix | 176-185 | 10 | |
| α-helix | 188-204 | 17 | |
| α-helix | 206-218 | 13 | |
| α-helix | 233-241 | 9 | |
| α-helix | 308-323 | 16 | |
| α-helix | 324-326 | 3 | |
| α-helix | 330-342 | 13 | |
| α-helix | 343-347 | 5 | |
| β-strand | 361-365 | 5 | 1 |
| α-helix | 368-370 | 3 | |
| β-strand | 372-373 | 2 | 1 |
| β-strand | 382-390 | 9 | 1 |
| α-helix | 400-402 | 3 | |
| α-helix | 522-532 | 11 | |
| β-strand | 541-549 | 9 | 1 |
| α-helix | 555-573 | 19 | |
| β-strand | 585-587 | 3 | 1 |
| β-strand | 593-595 | 3 | 1 |
| α-helix | 597-598 | 2 | |
| β-strand | 601-603 | 3 | 2 |
| α-helix | 604-611 | 8 | |
| α-helix | 615-623 | 9 | |
| β-strand | 628 | 1 | 3 |
| α-helix | 629-652 | 24 | |
| β-strand | 662-665 | 4 | 2 |
| β-strand | 670-672 | 3 | 2 |
| α-helix | 697-702 | 6 | |
| α-helix | 709-726 | 18 | |
| α-helix | 729-739 | 11 | |
| α-helix | 746-748 | 3 | |
| α-helix | 753-759 | 7 | |
| α-helix | 767-783 | 17 | |
Chain B: 10 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7 | 1 | 4 |
| β-strand | 10-18 | 9 | 5 |
| α-helix | 24-33 | 10 | |
| β-strand | 47-55 | 9 | 5 |
| β-strand | 58-66 | 9 | 5 |
| α-helix | 71-73 | 3 | |
| α-helix | 74-77 | 4 | |
| α-helix | 78-81 | 4 | |
| β-strand | 86-92 | 7 | 5 |
| α-helix | 96-100 | 5 | |
| α-helix | 102-107 | 6 | |
| α-helix | 109-112 | 4 | |
| β-strand | 118-124 | 7 | 5 |
| α-helix | 129-131 | 3 | |
| α-helix | 136-145 | 10 | |
| β-strand | 149-153 | 5 | 5 |
| α-helix | 161-173 | 13 | |
Chain C: 27 helices, 9 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 129-134 | 6 | |
| α-helix | 141-150 | 10 | |
| α-helix | 154-163 | 10 | |
| α-helix | 164-166 | 3 | |
| α-helix | 169-173 | 5 | |
| α-helix | 176-185 | 10 | |
| α-helix | 188-204 | 17 | |
| α-helix | 206-218 | 13 | |
| α-helix | 232-242 | 11 | |
| α-helix | 308-323 | 16 | |
| α-helix | 324-326 | 3 | |
| α-helix | 330-342 | 13 | |
| α-helix | 343-347 | 5 | |
| β-strand | 361-365 | 5 | 6 |
| α-helix | 368-370 | 3 | |
| β-strand | 372-373 | 2 | 6 |
| β-strand | 382-390 | 9 | 6 |
| α-helix | 398-402 | 5 | |
| α-helix | 522-532 | 11 | |
| β-strand | 541-549 | 9 | 6 |
| α-helix | 555-573 | 19 | |
| β-strand | 585-589 | 5 | 6 |
| β-strand | 592-595 | 4 | 6 |
| α-helix | 596-598 | 3 | |
| β-strand | 601-603 | 3 | 7 |
| α-helix | 604-609 | 6 | |
| α-helix | 615-623 | 9 | |
| α-helix | 629-652 | 24 | |
| β-strand | 662-665 | 4 | 7 |
| β-strand | 670-672 | 3 | 7 |
| α-helix | 697-702 | 6 | |
| α-helix | 709-726 | 18 | |
| α-helix | 729-739 | 11 | |
| α-helix | 746-748 | 3 | |
| α-helix | 753-759 | 7 | |
| α-helix | 767-783 | 17 | |
Chain D: 9 helices, 7 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 7 | 1 | 3 |
| β-strand | 10-18 | 9 | 8 |
| α-helix | 24-33 | 10 | |
| β-strand | 46-55 | 10 | 8 |
| β-strand | 58-67 | 10 | 8 |
| α-helix | 71-73 | 3 | |
| α-helix | 74-77 | 4 | |
| α-helix | 78-81 | 4 | |
| β-strand | 86-92 | 7 | 8 |
| α-helix | 96-100 | 5 | |
| α-helix | 104-107 | 4 | |
| β-strand | 118-124 | 7 | 8 |
| α-helix | 129-131 | 3 | |
| α-helix | 136-145 | 10 | |
| β-strand | 149-153 | 5 | 8 |
| α-helix | 161-181 | 21 | |
Chain E: 27 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 129-134 | 6 | |
| α-helix | 141-150 | 10 | |
| α-helix | 154-163 | 10 | |
| α-helix | 164-166 | 3 | |
| α-helix | 169-173 | 5 | |
| α-helix | 176-185 | 10 | |
| α-helix | 188-204 | 17 | |
| α-helix | 206-219 | 14 | |
| α-helix | 233-242 | 10 | |
| α-helix | 308-323 | 16 | |
| α-helix | 324-326 | 3 | |
| α-helix | 330-342 | 13 | |
| α-helix | 343-347 | 5 | |
| β-strand | 361-365 | 5 | 9 |
| α-helix | 368-370 | 3 | |
| β-strand | 372-373 | 2 | 9 |
| β-strand | 382-390 | 9 | 9 |
| α-helix | 398-402 | 5 | |
| α-helix | 522-532 | 11 | |
| β-strand | 541-549 | 9 | 9 |
| α-helix | 555-573 | 19 | |
| β-strand | 585-589 | 5 | 9 |
| β-strand | 592-595 | 4 | 9 |
| α-helix | 597-598 | 2 | |
| β-strand | 601-603 | 3 | 10 |
| α-helix | 604-611 | 8 | |
| α-helix | 615-623 | 9 | |
| β-strand | 628 | 1 | 4 |
| α-helix | 629-652 | 24 | |
| β-strand | 655 | 1 | 11 |
| β-strand | 662-665 | 4 | 10 |
| β-strand | 670-672 | 3 | 10 |
| β-strand | 692 | 1 | 11 |
| α-helix | 697-702 | 6 | |
| α-helix | 709-726 | 18 | |
| α-helix | 729-739 | 11 | |
| α-helix | 746-748 | 3 | |
| α-helix | 753-759 | 7 | |
| α-helix | 767-783 | 17 | |
Chain F: 10 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10-18 | 9 | 12 |
| α-helix | 24-33 | 10 | |
| β-strand | 46-55 | 10 | 12 |
| β-strand | 58-67 | 10 | 12 |
| α-helix | 71-73 | 3 | |
| α-helix | 74-77 | 4 | |
| α-helix | 78-81 | 4 | |
| β-strand | 86-92 | 7 | 12 |
| α-helix | 96-100 | 5 | |
| α-helix | 104-107 | 4 | |
| β-strand | 118-124 | 7 | 12 |
| α-helix | 129-131 | 3 | |
| α-helix | 136-145 | 10 | |
| β-strand | 149-153 | 5 | 12 |
| α-helix | 161-176 | 16 | |
| α-helix | 178-181 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Phosphatidylinositol 4-kinase beta | A, C, E | protein | 566 | HOMO SAPIENS | Q9UBF8 (AlphaFold model) |
| Ras-related protein rab-11A | B, D, F | protein | 219 | HOMO SAPIENS | P62491 (AlphaFold model) |
Sequence of entity 1 (A, C, E), FASTA
>4D0L_1 PHOSPHATIDYLINOSITOL 4-KINASE BETA (chains A, C, E)
GSQNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQ
LLNMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRK
LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTAANPKV
ENEDEPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLNHKLPARVWLPTAG
FDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPENRRDPEDPSAVAL
KEPWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPL
WIKPYKILVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNF
VQSCAGYCLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTE
FVDVMGGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLK
ERFHMSMTEEQLQLLVEQMVDGSMRS
Sequence of entity 2 (B, D, F), FASTA
>4D0L_2 RAS-RELATED PROTEIN RAB-11A (chains B, D, F)
GSHMGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDG
KTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNI
VIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVS
QKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 093 | N-(5-(4-chloro-3-(2-hydroxy-ethylsulfamoyl)- phenylthiazole-2-yl)-acetamide | C14 H16 Cl N3 O4 S2 | 3 |
| GSP | 5'-guanosine-diphosphate-monothiophosphate | C10 H16 N5 O13 P3 S | 3 |
| MG | Magnesium ion | Mg | 3 |
Primary citation
Structures of Pi4Kiiibeta Complexes Show Simultaneous Recruitment of Rab11 and its Effectors. Burke, J.E., Inglis, A.J., Perisic, O. et al. Science (2014) 344:1035. DOI 10.1126/SCIENCE.1253397 · PubMed
Other PDB entries of the same protein (UniProt Q9UBF8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8Q6F 1.51 Å, Human PI4KIIIB in complex with covalently bound inhibitor (compound 4)
- 8Q6G 1.54 Å, Human PI4KIIIB in complex with covalently bound inhibitor (compound 8)
- 8Q6H 1.94 Å, Human PI4KIIIB in complex with covalently bound inhibitor (compound 11)
- 5NAS 2.08 Å, Crystal structure of human 14-3-3 zeta in complex with PI4KIIIB peptide
- 5LX2 2.58 Å, Lt 14-3-3 in complex with PI4KIIIB peptide
- 5C46 2.65 Å, Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta…
- 6GL3 2.77 Å, Crystal structure of human Phosphatidylinositol 4-kinase III beta (PI4KIIIbeta) in…
- 8VOF 3.0 Å, GI targeted CpPI4K inhibitor
- 5C4G 3.2 Å, Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta…
- 5EUQ 3.2 Å, Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta…
- 5FBR 3.28 Å, PI4KB in complex with Rab11 and the MI359 Inhibitor
- 5FBV 3.29 Å, PI4KB in complex with Rab11 and the MI364 Inhibitor
Browse structure collections
About this viewer
MolViewer shows 4D0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.