4D0P: Human CSN4

Crystal structure of human CSN4. Determined by X-ray diffraction at 1.6 Å resolution. Released 23 Jul 2014.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 3,343
Mol. weight: 44.58 kDa
Released: 23 Jul 2014

Explore 4D0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D0P contains 26 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	0-12	13
α-helix	19-34	16
α-helix	39-53	15
α-helix	59-72	14
α-helix	73-75	3
α-helix	78-92	15
α-helix	93-99	7
α-helix	100-116	17
α-helix	120-128	9
α-helix	141-157	17
α-helix	161-172	12
α-helix	175-177	3
α-helix	181-197	17
α-helix	201-211	11
α-helix	219-235	17
α-helix	237	1
α-helix	240-251	12
α-helix	253-257	5
α-helix	261-268	8
α-helix	271-274	4
α-helix	275-278	4
α-helix	279-283	5
α-helix	287-290	4
β-strand	292	1	1
β-strand	298	1	1
α-helix	299-315	17
β-strand	318-320	3	2
α-helix	321-328	8
α-helix	332-344	13
β-strand	350-353	4	2
β-strand	358-361	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COP9 signalosome complex subunit 4	A	protein	387	HOMO SAPIENS	Q9BT78 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4D0P_1 COP9 SIGNALOSOME COMPLEX SUBUNIT 4 (chains A)
MASWSHPQFEKVDEENLYFQGGGRMAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQL
SGAEQLEALKAFVEAMVNENVSLVISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRV
ISFEEQVASIRQHLASIYEKEEDWRNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYL
EDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTI
VHESERLEALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGN
QLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAE
KIASQMITEGRMNGFIDQIDGIVHFET

Primary citation

Crystal Structure of the Cop9 Signalosome. Lingaraju, G.M., Bunker, R.D., Cavadini, S. et al. Nature (2014) 512:161. DOI 10.1038/NATURE13566 · PubMed

Other PDB entries of the same protein (UniProt Q9BT78 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QO4 2.95 Å, Dissociation-state-3 of 9-subunit CSN and SCF (SKP1-SKP2-CKS1) complex
9EFQ 2.96 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-2
9PH4 3.0 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-1a
9QO6 3.0 Å, 9-subunit COP9 signalosome complex
9EFV 3.03 Å, Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3
9EFM 3.16 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-1
9QO1 3.23 Å, Activated 9-subunit COP9 signalosome and neddylated SCF (SKP1-SKP2-CKS1) complex structure
9QO0 3.26 Å, Pre-activated 9-subunit COP9 signalosome and neddylated SCF (Skp1-Skp2-Cks1) complex…
9E77 3.3 Å, Cryo-EM structure of CSN-N8 in complex with CSN5i-3
9E81 3.3 Å, Cryo-EM structure of COP9 signalosome in complex with CSN5i-3
9EG8 3.39 Å, Cryo-EM structure of COP9 signalosome precatalytic state with neddylated cullin-4A
9E5Z 3.4 Å, Cryo-EM structure of COP9 signalosome

Browse structure collections

About this viewer

MolViewer shows 4D0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.