4D28: Kinase domain of CIPK24/SOS2

Crystal structure of the kinase domain of CIPK24/SOS2. Determined by X-ray diffraction at 3.3 Å resolution. Released 15 Oct 2014.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: ARABIDOPSIS THALIANA
Chains: 4
Atoms: 8,821
Mol. weight: 203.06 kDa
Released: 15 Oct 2014

Explore 4D28 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4D28 contains 56 α-helices and 43 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	1
β-strand	24-30	7	1
β-strand	35-43	9	1
α-helix	44-48	5
α-helix	53-65	13
β-strand	71	1	2
β-strand	77-79	3	1
β-strand	83-88	6	1
β-strand	94-95	2	2
α-helix	97-103	7
α-helix	106-107	2
α-helix	108-127	20
β-strand	140-142	3	2
β-strand	148-150	3	2
α-helix	178-182	5
α-helix	188-205	18
α-helix	215-224	10
α-helix	235-244	10
α-helix	253-254	2
α-helix	255-260	6
α-helix	262-265	4
α-helix	281-286	6

Chain B: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	3
β-strand	11-13	3	3
β-strand	20	1	4
β-strand	23	1	4
β-strand	24-30	7	3
β-strand	36-43	8	3
α-helix	44-48	5
α-helix	53-65	13
β-strand	71	1	5
β-strand	74-79	6	3
β-strand	83-89	7	3
β-strand	95	1	5
α-helix	97-103	7
α-helix	106-107	2
α-helix	108-128	21
α-helix	137-139	3
β-strand	140-142	3	5
β-strand	148-150	3	5
α-helix	178-181	4
α-helix	188-205	18
α-helix	215-224	10
α-helix	228-230	3
α-helix	235-244	10
α-helix	253-254	2
α-helix	255-259	5
α-helix	262-265	4
α-helix	270-272	3
α-helix	281-286	6

Chain C: 14 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	6
β-strand	11	1	6
β-strand	12-13	2	7
β-strand	24-29	6	7
β-strand	36-43	8	7
α-helix	44-48	5
α-helix	53-65	13
β-strand	71	1	8
β-strand	74-79	6	7
β-strand	83-89	7	7
β-strand	95	1	8
α-helix	96-103	8
α-helix	106-107	2
α-helix	108-127	20
α-helix	137-139	3
β-strand	140-142	3	8
β-strand	148-150	3	8
α-helix	178-182	5
α-helix	188-205	18
α-helix	215-224	10
α-helix	235-244	10
α-helix	253-254	2
α-helix	255-259	5
α-helix	262-265	4
α-helix	281-286	6

Chain D: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	9
β-strand	24-26	3	10
β-strand	28-29	2	9
β-strand	30	1	11
α-helix	31-33	3
β-strand	35	1	11
β-strand	39-43	5	10
α-helix	44-48	5
α-helix	53-64	12
β-strand	71	1	12
β-strand	74-79	6	10
β-strand	83-88	6	10
α-helix	96-103	8
α-helix	108-127	20
β-strand	140-142	3	12
β-strand	148-150	3	12
α-helix	178-182	5
α-helix	188-205	18
α-helix	215-224	10
α-helix	235-244	10
α-helix	253-254	2
α-helix	255-259	5
α-helix	262-265	4
α-helix	281-286	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cbl-interacting serine/threonine-protein kinase 24	A, B, C, D	protein	446	ARABIDOPSIS THALIANA	Q9LDI3 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4D28_1 CBL-INTERACTING SERINE/THREONINE-PROTEIN KINASE 24 (chains A, B, C, D)
MTKKMRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREI
SIMKIVRHPNIVRLYEVLASKSKIYIVLEFVTGGELFDRIVHKGRLKEDESRKYFQQLVD
AVAHCHSKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLNDTCGTPNYVAPEV
LSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFDCPPWFSAEVKFL
IHRILDPNPKTRIQIQGIKKDPWFRKNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENV
ERNDEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANS
MGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKL
CSKLENIIWRATEGIPKSEILRTITF

Primary citation

Structural Basis of the Regulatory Mechanism of the Plant Cipk Family of Protein Kinases Controlling Ion Homeostasis and Abiotic Stress. Chaves-Sanjuan, A., Sanchez-Barrena, M.J., Gonzalez-Rubio, J.M. et al. Proc Natl Acad Sci U S A (2014) 111:E4532. DOI 10.1073/PNAS.1407610111 · PubMed

Other PDB entries of the same protein (UniProt Q9LDI3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2EHB 2.1 Å, The structure of the C-terminal domain of the protein kinase AtSOS2 bound to the calcium…

Browse structure collections

About this viewer

MolViewer shows 4D28 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.