4DAG: Fusion glycoprotein F0

Structure of the Human Metapneumovirus Fusion Protein with Neutralizing Antibody Identifies a Pneumovirus Antigenic Site. Determined by X-ray diffraction at 3.39 Å resolution. Released 29 Feb 2012.

Method: X-ray diffraction
Resolution: 3.39 Å
Organisms: Human metapneumovirus, Homo sapiens
Chains: 3
Atoms: 6,064
Mol. weight: 92.41 kDa
Released: 29 Feb 2012

Explore 4DAG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DAG contains 25 α-helices and 73 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	20-24	5	1
β-strand	29-36	8	1
β-strand	37-50	14	2
α-helix	72-84	13
α-helix	85-91	7
α-helix	92-93	2
α-helix	118-123	6
α-helix	124-126	3
α-helix	127-130	4
α-helix	138-142	5
β-strand	152	1	3
β-strand	158	1	3
β-strand	159-163	5	2
α-helix	200-209	10
β-strand	213-214	2	2
α-helix	224-232	9
α-helix	239-246	8
α-helix	249-252	4
β-strand	256-261	6	2
β-strand	267-278	12	2
β-strand	282-288	7	1
β-strand	291-293	3	4
β-strand	300-304	5	4
β-strand	308-312	5	1
β-strand	317-320	4	1
β-strand	326-329	4	2
β-strand	332-336	5	2
β-strand	342-343	2	1
α-helix	345-347	3
α-helix	349-352	4
β-strand	363-366	4	4
β-strand	372-375	4	5
β-strand	380-383	4	5
β-strand	391-393	3	6
β-strand	402	1	6
β-strand	407-410	4	5
β-strand	417-419	3	6
β-strand	424-426	3	6
α-helix	427	1

Chain H: 4 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
α-helix	8	1
β-strand	10-12	3	8
β-strand	16-25	10	7
β-strand	33-39	7	9
β-strand	45-51	7	9
β-strand	57-59	3	9
β-strand	68-71	4	7
β-strand	77-85	9	7
α-helix	87-89	3
β-strand	91	1	8
β-strand	92-98	7	9
β-strand	109-112	4	9
β-strand	118-120	3	8
β-strand	126	1	10
β-strand	129-133	5	11
α-helix	134-136	3
β-strand	144-147	4	12
β-strand	148-154	7	11
β-strand	155	1	10
β-strand	160-163	4	13
β-strand	172-173	2	12
β-strand	178-179	2	11
β-strand	185-188	4	11
β-strand	190-194	5	12
β-strand	198	1	14
β-strand	201	1	14
β-strand	204-209	6	13
α-helix	210-212	3
β-strand	214-219	6	13

Chain L: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	38-43	6	15
β-strand	54-57	4	16
α-helix	62-63	2
β-strand	64-67	4	16
α-helix	73-74	2
β-strand	81-86	6	15
β-strand	89-94	6	15
α-helix	99-101	3
β-strand	104-111	8	16
β-strand	114-122	9	16
α-helix	127-130	4
β-strand	131	1	17
β-strand	136-138	3	18
α-helix	139-141	3
α-helix	142-146	5
β-strand	150-151	2	19
β-strand	153-155	3	18
β-strand	159	1	20
β-strand	160	1	17
β-strand	165-170	6	21
β-strand	173-174	2	21
β-strand	179-181	3	18
β-strand	185-186	2	20
β-strand	192-193	2	20
β-strand	195-198	4	18
β-strand	199-200	2	19
α-helix	202-206	5
β-strand	211-216	6	21
β-strand	221-226	6	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion glycoprotein F0	A	protein	415	Human metapneumovirus	G3KCK8
Neutralizing Antibody DS7 heavy chain	H	protein	220	Homo sapiens	P01857 (AlphaFold model)
Neutralizing Antibody DS7 light chain	L	protein	213	Homo sapiens	Q8N5F4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4DAG_1 Fusion glycoprotein F0 (chains A)
GLKESYLEESCSTITEGYLSVLRTGWYTNVFTLEVGDVENLTCTDGPSLIKTELDLTKSA
LRELKTVSADQLAREEQIENPRQSRFVLGAIALGVATAAAVTAGIAIAKTIRLESEVNAI
KGALKTTNEAVSTLGNGVRVLATAVRELKEFVSKNLTSAINKNKCDIADLKMAVSFSQFN
RRFLNVVRQFSDNAGITPAISLDLMTDAELARAVSYMPTSAGQIKLMLENRAMVRRKGFG
ILIGVYGSSVIYMVQLPIFGVIDTPCWIIKAAPSCSEKDGNYACLLREDQGWYCKNAGST
VYYPNDKDCETRGDHVFCDTAAGINVAEQSRECNINISTTNYPCKVSTGRHPISMVALSP
LGALVACYKGVSCSIGSNRVGIIKQLPKGCSYITNQDADTVTIDNTVYQLSKVEG

Sequence of entity 2 (H), FASTA

>4DAG_2 Neutralizing Antibody DS7 heavy chain (chains H)
EVQLLESGGGLVQPGGSRRLSCAASGFTVSSSYMSWVRQTPGKGLEWISVFYSGGTTYYA
DAVKGRFSISMDTSKNTLHLQMNSLRVEDTAIYYCARVLSRASGMPDAFDIWGPGTMVTV
SSASTKGPSVFPLAPSSAATSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV

Sequence of entity 3 (L), FASTA

>4DAG_3 Neutralizing Antibody DS7 light chain (chains L)
ELALIQPASVSVSPGQTASITCSGDKLGDKYASWYQQKPGQSPVLVIYQDSERPSGIPER
FSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGGTTLTVLGQPKAAPSVTLFPP
SSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSL
TPEQWKSHRSYSCQVTHEGSTVEKTVAPTECSM

Primary citation

Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site. Wen, X., Krause, J.C., Leser, G.P. et al. Nat Struct Mol Biol (2012) 19:461-463. DOI 10.1038/nsmb.2250 · PubMed

Other PDB entries of the same protein (UniProt G3KCK8), best resolution first:

8T9Z 3.0 Å, Structural of M8C10 Fab in complex human metapneumovirus fusion protein
8F6X 3.25 Å, cryo-EM structure of a structurally designed Human metapneumovirus F protein in complex…

Browse structure collections

About this viewer

MolViewer shows 4DAG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.