4DG3: PDB entry 4DG3

Crystal structure of R336A mutant of cAMP-dependent protein kinase with unphosphorylated turn motif. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Feb 2013.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,171
Mol. weight: 45.65 kDa
Ligands: MG, ANP
Released: 13 Feb 2013

Explore 4DG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4DG3 contains 20 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	6-11	6
α-helix	18-21	4
β-strand	22	1	5

Chain E: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	15-31	17
α-helix	40-42	3
β-strand	43-51	9	1
β-strand	56-62	7	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-95	11
β-strand	103	1	2
α-helix	104-105	2
β-strand	106-111	6	1
β-strand	115-121	7	1
β-strand	127	1	2
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	3
α-helix	169-171	3
β-strand	172-174	3	2
β-strand	180-182	3	2
β-strand	189-190	2	3
β-strand	195	1	4
β-strand	200	1	5
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	4
α-helix	218-233	16
α-helix	243-252	10
α-helix	263-272	10
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-306	5
α-helix	311-312	2
α-helix	334-336	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase catalytic subunit alpha	E	protein	371	Mus musculus	P05132 (AlphaFold model)
cAMP-dependent protein kinase inhibitor alpha	A	protein	20	Mus musculus	P63248 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>4DG3_1 cAMP-dependent protein kinase catalytic subunit alpha (chains E)
MGSSHHHHHHSSGLVPRGSHMGNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQ
LDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVN
FPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHS
LDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAV
DWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK
RFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIAVSI
NEKCGKEFTEF

Sequence of entity 2 (A), FASTA

>4DG3_2 cAMP-dependent protein kinase inhibitor alpha (chains A)
TTYADFIASGRTGRRNAIHD

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1

Primary citation

Turn motif phosphorylation regulates processing of cAMP-dependent protein kinase. Steichen, J.M., Yang, J., Taylor, S.S. To be published.

Other PDB entries of the same protein (UniProt P05132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RDQ 1.26 Å, Hydrolysis of ATP in the crystal of Y204A mutant of cAMP-dependent protein kinase
4DFX 1.35 Å, Crystal structure of myristoylated K7C catalytic subunit of cAMP-dependent protein…
4HPU 1.55 Å, Crystal structure of the catalytic subunit of cAMP-dependent protein kinase displaying…
4IAI 1.55 Å, X-ray Structure of cAMP dependent protein kinase A in complex with high Ca2+…
9PC1 1.55 Å, Co-crystal structure of the cAMP-dependent protein kinase catalytic subunit alpha with…
3FJQ 1.6 Å, Crystal structure of cAMP-dependent protein kinase catalytic subunit alpha in complex…
4IAK 1.6 Å, Low temperature X-ray structure of cAMP dependent protein kinase A in complex with high…
3IDB 1.62 Å, Crystal structure of (108-268)RIIb:C holoenzyme of cAMP-dependent protein kinase
4IB1 1.63 Å, Structure of cAMP dependent protein kinase A in complex with high K+ concentration, ADP…
7V0G 1.63 Å, Structure of cAMP-dependent protein kinase using a MD-MX procedure, produced using 1.63…
3QAL 1.7 Å, Crystal Structure of Arg280Ala mutant of Catalytic subunit of cAMP-dependent Protein…
3X2W 1.7 Å, Michaelis complex of cAMP-dependent Protein Kinase Catalytic Subunit

Browse structure collections

About this viewer

MolViewer shows 4DG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.