Crystal structure of thrombin bound to the activation domain QEDQVDPRLIDGKMTRRGDS of protein C. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 May 2012.
Explore 4DT7 in 3D Show helices and sheets RCSB PDB PDBe
4DT7 contains 28 α-helices and 45 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-10 | 3 | |
| α-helix | 14C-14K | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-36 | 7 | 3 |
| β-strand | 38-46 | 9 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-59 | 4 | |
| β-strand | 60-60A | 2 | 4 |
| α-helix | 60B-60D | 3 | |
| β-strand | 60F-60G | 2 | 4 |
| α-helix | 61-63 | 3 | |
| β-strand | 65-68 | 4 | 3 |
| β-strand | 72 | 1 | 5 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-114 | 4 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-125 | 3 | |
| α-helix | 126-129C | 7 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 154 | 1 | 5 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 2 |
| α-helix | 186-186B | 3 | |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-202 | 5 | 2 |
| β-strand | 207-216 | 10 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 232-234 | 3 | |
| α-helix | 235-245 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 6 |
| β-strand | 20-21 | 2 | 7 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 8 |
| β-strand | 39-46 | 8 | 8 |
| β-strand | 51-54 | 4 | 8 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-60A | 2 | 9 |
| α-helix | 60B-60D | 3 | |
| β-strand | 60F-60G | 2 | 9 |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 8 |
| β-strand | 72 | 1 | 10 |
| β-strand | 81-83 | 3 | 8 |
| β-strand | 85-90 | 6 | 8 |
| β-strand | 95 | 1 | 11 |
| β-strand | 100 | 1 | 11 |
| β-strand | 104-108 | 5 | 8 |
| α-helix | 111-114 | 4 | |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 7 |
| α-helix | 123-124 | 2 | |
| α-helix | 126-129C | 7 | |
| β-strand | 135-140 | 6 | 7 |
| β-strand | 154 | 1 | 10 |
| β-strand | 156-162 | 7 | 7 |
| α-helix | 165-170 | 6 | |
| β-strand | 180-183 | 4 | 7 |
| α-helix | 186-186B | 3 | |
| β-strand | 189 | 1 | 6 |
| β-strand | 198-202 | 5 | 7 |
| β-strand | 207-216 | 10 | 7 |
| β-strand | 226-230 | 5 | 7 |
| α-helix | 232-234 | 3 | |
| α-helix | 235-244 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-40 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Thrombin light chain | A, C | protein | 32 | Homo sapiens | P00734 (AlphaFold model) |
| Thrombin heavy chain | B, D | protein | 259 | Homo sapiens | P00734 (AlphaFold model) |
| Vitamin K-dependent protein C | E, F | protein | 20 | Homo sapiens | P04070 (AlphaFold model) |
>4DT7_1 Thrombin light chain (chains A, C) GEADCGLRPLFEKKSLEDKTERELLESYIDGR
>4DT7_2 Thrombin heavy chain (chains B, D) IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLL VRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCL PDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIR ITDNMFCAGYKPDEGKRGDACEGDAGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFY THVFRLKKWIQKVIDQFGE
>4DT7_3 Vitamin K-dependent protein C (chains E, F) QEDQVDPRLIDGKMTRRGDS
Exposure of R169 controls protein C activation and autoactivation. Pozzi, N., Barranco-Medina, S., Chen, Z. et al. Blood (2012) 120:664-670. DOI 10.1182/blood-2012-03-415323 · PubMed
Other PDB entries of the same protein (UniProt P00734 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4DT7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.