4EBR: Autophagic E2, Atg10

Crystal structure of Autophagic E2, Atg10. Determined by X-ray diffraction at 2.7 Å resolution. Released 3 Oct 2012.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 2,642
Mol. weight: 40.62 kDa
Ligands: HG
Released: 3 Oct 2012

Explore 4EBR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EBR contains 17 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-16	13
β-strand	26-31	6	1
β-strand	38-42	5	1
β-strand	45	1	1
β-strand	61-70	10	1
β-strand	75-88	14	1
β-strand	91-96	6	1
α-helix	97-98	2
α-helix	99-106	8
β-strand	117-122	6	1
β-strand	125-129	5	1
α-helix	135-137	3
α-helix	146-149	4
α-helix	150-154	5
α-helix	155-159	5
α-helix	160-162	3

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-17	14
β-strand	26-31	6	1
β-strand	38-42	5	1
α-helix	43-44	2
β-strand	45	1	1
β-strand	61-70	10	1
β-strand	75-88	14	1
β-strand	91-96	6	1
α-helix	97-98	2
α-helix	99-107	9
β-strand	117-122	6	1
β-strand	125-129	5	1
α-helix	130	1
α-helix	135-137	3
α-helix	146-148	3
α-helix	149-154	6
α-helix	155-159	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like-conjugating enzyme ATG10	A, B	protein	169	Saccharomyces cerevisiae	Q07879 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4EBR_1 Ubiquitin-like-conjugating enzyme ATG10 (chains A, B)
GSMIPYQEWHSQLQSLYDSQIFHNWALCQDVHLNDEKDGLLLRLIPTRQLQKNTERIENK
LLNHIELYLTYSKVYNEPLLLLRIWEEKSIDGIPMTKLMLPTDIESLLDVQGKFQLGLDT
IINLEGSVWYSFHPCDTSCIVGDQAEFMSTYLRRWVSIFIFSWLGYEDS

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	2

Primary citation

Structure of the autophagic E2 enzyme Atg10. Hong, S.B., Kim, B.W., Kim, J.H. et al. Acta Crystallogr D Biol Crystallogr (2012) 68:1409-1417. DOI 10.1107/S0907444912034166 · PubMed

Other PDB entries of the same protein (UniProt Q07879 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GSK 2.9 Å, Crystal structure of an Atg7-Atg10 crosslinked complex

Browse structure collections

About this viewer

MolViewer shows 4EBR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.