4EDS: Far-red fluorescent protein eqFP670

Name: PDB 4EDS: Crystal structure of far-red fluorescent protein eqFP670
Published: 2012-09-05
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Crystal structure of far-red fluorescent protein eqFP670. Determined by X-ray diffraction at 1.6 Å resolution. Released 5 Sept 2012.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Entacmaea quadricolor
Chains: 2
Atoms: 4,311
Mol. weight: 54.67 kDa
Released: 5 Sept 2012

Explore 4EDS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EDS contains 11 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	9-19	11	1
β-strand	22-33	12	1
β-strand	38-47	10	1
α-helix	49	1
α-helix	51	1
α-helix	55-61	7
β-strand	71-72	2	1
α-helix	79-82	4
β-strand	88-96	9	1
β-strand	101-111	11	1
β-strand	114-124	11	1
α-helix	131-134	4
β-strand	137-140	4	1
β-strand	143-150	8	1
β-strand	153-164	12	1
β-strand	169-180	12	1
α-helix	184-186	3
β-strand	193-205	13	1
β-strand	210-220	11	1

Chain B: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	9-19	11	2
β-strand	22-33	12	2
β-strand	38-47	10	2
α-helix	49	1
α-helix	51	1
α-helix	55-61	7
β-strand	71-72	2	2
α-helix	79-82	4
β-strand	88-96	9	2
β-strand	101-111	11	2
β-strand	114-124	11	2
β-strand	137-140	4	2
β-strand	143-150	8	2
β-strand	153-164	12	2
β-strand	169-180	12	2
α-helix	184-186	3
β-strand	193-205	13	2
β-strand	210-220	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
far-red fluorescent protein eqFP650	A, B	protein	241	Entacmaea quadricolor	J9PBR8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4EDS_1 far-red fluorescent protein eqFP650 (chains A, B)
MRGSHHHHHHGSDSELISENMHTKLYMEGTVNGHHFKCTSEGEGKPYEGTQTCKIKVVEG
GPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERITTYEDGGVLTATQDT
SLQNGCLIYNVKINGVNFPSNGPVMQKKTLGWEANTEMLYPADSGLRGHNQMALKLVGGG
YLHCSLKTTYRSKKPAKNLKMPGFYFVDRKLERIKEADKETYVEQHEMAVARYCDLPSKL
GHS

Primary citation

Structural basis for bathochromic shift of fluorescence in far-red fluorescent proteins eqFP650 and eqFP670. Pletnev, S., Pletneva, N.V., Souslova, E.A. et al. Acta Crystallogr D Biol Crystallogr (2012) 68:1088-1097. DOI 10.1107/S0907444912020598 · PubMed

Browse more

4EDS is part of these collections:

Fluorescent and glowing proteins

About this viewer

MolViewer shows 4EDS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.