4EEE: YLDV 14L IL-18 Binding Protein

Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18. Determined by X-ray diffraction at 2.71 Å resolution. Released 26 Sept 2012.

Method: X-ray diffraction
Resolution: 2.71 Å
Organisms: Yaba-like disease virus, Homo sapiens
Chains: 4
Atoms: 4,240
Mol. weight: 63.91 kDa
Released: 26 Sept 2012

Explore 4EEE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EEE contains 17 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	25-32	8	1
β-strand	38-47	10	1
β-strand	54-59	6	2
β-strand	63-64	2	2
α-helix	65-67	3
α-helix	69	1
β-strand	74-78	5	1
β-strand	89	1	1
β-strand	92-98	7	1
α-helix	102-106	5
β-strand	109-114	6	2
β-strand	120-124	5	2
α-helix	126-130	5

Chain B: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-13	12	3
α-helix	18	1
β-strand	19-22	4	3
β-strand	28-31	4	3
β-strand	47-54	8	3
β-strand	61-66	6	3
β-strand	73-75	3	3
α-helix	77-79	3
β-strand	82-84	3	3
α-helix	87-89	3
β-strand	91-92	2	3
β-strand	101-106	6	3
β-strand	109-117	9	3
β-strand	123-130	8	3
β-strand	133-140	8	3
α-helix	147-149	3
β-strand	151-154	4	3

Chain C: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	20-22	3
β-strand	25-32	8	1
β-strand	38-47	10	1
β-strand	54-59	6	4
β-strand	63-64	2	4
α-helix	65-67	3
α-helix	69	1
β-strand	74-78	5	1
β-strand	89	1	1
β-strand	92-98	7	1
α-helix	102-106	5
β-strand	109-114	6	4
β-strand	120-124	5	4
α-helix	126-130	5

Chain D: 4 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	5
α-helix	18	1
β-strand	19-22	4	5
β-strand	28-31	4	5
β-strand	47-54	8	5
β-strand	61-66	6	5
β-strand	73-75	3	5
α-helix	77-79	3
β-strand	82-84	3	5
α-helix	87-89	3
β-strand	91-92	2	5
β-strand	101-106	6	5
β-strand	109-117	9	5
β-strand	124-129	6	5
β-strand	134-139	6	5
α-helix	147-149	3
β-strand	151-154	4	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14L protein	A, C	protein	118	Yaba-like disease virus	Q9DHU8 (AlphaFold model)
Interleukin-18	B, D	protein	157	Homo sapiens	Q14116 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4EEE_1 14L protein (chains A, C)
MECVKTRSVNIHVPVKETSKVVLECRGDSYFRHFSYVYWIIGKNKTVDQLPPNSGYRERI
YLFKKPHRCENRPRADLILTNITDEMRNEKLTCVLIDPKDPLKESVILSKIWNCVYKI

Sequence of entity 2 (B, D), FASTA

>4EEE_2 Interleukin-18 (chains B, D)
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDSRDNAPRTIFIISMYKDSQPRGM
AVTISVASAAASTLSSENKIISFKEMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSY
EGYFLASEKERDLFKLILKKEDELGDRSIMFTVQNED

Primary citation

A unique bivalent binding and inhibition mechanism by the yatapoxvirus interleukin 18 binding protein. Krumm, B., Meng, X., Wang, Z. et al. PLoS Pathog (2012) 8:e1002876-e1002876. DOI 10.1371/journal.ppat.1002876 · PubMed

Other PDB entries of the same protein (UniProt Q9DHU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EKX 1.75 Å, Crystal Structure of YLDV 14L IL-18 Binding Protein in Complex with Human IL-18

Browse structure collections

About this viewer

MolViewer shows 4EEE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.