Thr 160 phosphorylated CDK2 K89D, Q131E - human cyclin A3 complex with the inhibitor RO3306. Determined by X-ray diffraction at 2.0 Å resolution. Released 6 Feb 2013.
Explore 4EOI in 3D Show helices and sheets RCSB PDB PDBe
4EOI contains 74 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-12 | 9 | 1 |
| β-strand | 17-23 | 7 | 1 |
| β-strand | 29-36 | 8 | 1 |
| α-helix | 46-57 | 12 | |
| β-strand | 63 | 1 | 2 |
| β-strand | 66-71 | 6 | 1 |
| β-strand | 75-81 | 7 | 1 |
| β-strand | 85-86 | 2 | 2 |
| α-helix | 87-93 | 7 | |
| α-helix | 101-120 | 20 | |
| β-strand | 123-124 | 2 | 3 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-135 | 3 | 2 |
| β-strand | 141-143 | 3 | 2 |
| α-helix | 146-148 | 3 | |
| β-strand | 150-151 | 2 | 3 |
| α-helix | 166-168 | 3 | |
| α-helix | 171-174 | 4 | |
| α-helix | 183-198 | 16 | |
| α-helix | 208-219 | 12 | |
| α-helix | 230-232 | 3 | |
| α-helix | 240-242 | 3 | |
| α-helix | 248-251 | 4 | |
| α-helix | 257-266 | 10 | |
| α-helix | 275-276 | 2 | |
| α-helix | 277-280 | 4 | |
| α-helix | 284-286 | 3 | |
| α-helix | 292-295 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 179-192 | 14 | |
| α-helix | 199-202 | 4 | |
| α-helix | 208-224 | 17 | |
| α-helix | 229-243 | 15 | |
| α-helix | 250-252 | 3 | |
| α-helix | 253-268 | 16 | |
| α-helix | 272-274 | 3 | |
| α-helix | 275-280 | 6 | |
| α-helix | 288-301 | 14 | |
| α-helix | 311-319 | 9 | |
| α-helix | 327-342 | 16 | |
| α-helix | 344-347 | 4 | |
| α-helix | 352-367 | 16 | |
| α-helix | 374-380 | 7 | |
| α-helix | 384-400 | 17 | |
| α-helix | 401-403 | 3 | |
| α-helix | 408-412 | 5 | |
| α-helix | 416-418 | 3 | |
| α-helix | 421-423 | 3 | |
| α-helix | 425-427 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-12 | 9 | 4 |
| β-strand | 17-23 | 7 | 4 |
| β-strand | 29-36 | 8 | 4 |
| β-strand | 38 | 1 | 5 |
| β-strand | 43 | 1 | 5 |
| α-helix | 46-57 | 12 | |
| β-strand | 63 | 1 | 6 |
| β-strand | 66-70 | 5 | 4 |
| β-strand | 75-81 | 7 | 4 |
| β-strand | 85-86 | 2 | 6 |
| α-helix | 87-93 | 7 | |
| α-helix | 101-120 | 20 | |
| β-strand | 123-124 | 2 | 7 |
| α-helix | 130-132 | 3 | |
| β-strand | 133-135 | 3 | 6 |
| β-strand | 141-143 | 3 | 6 |
| α-helix | 146-148 | 3 | |
| β-strand | 150-151 | 2 | 7 |
| α-helix | 166-168 | 3 | |
| α-helix | 171-174 | 4 | |
| α-helix | 183-198 | 16 | |
| α-helix | 208-219 | 12 | |
| α-helix | 243-247 | 5 | |
| α-helix | 248-250 | 3 | |
| α-helix | 257-266 | 10 | |
| α-helix | 275-276 | 2 | |
| α-helix | 277-280 | 4 | |
| α-helix | 284-286 | 3 | |
| α-helix | 292-295 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 179-192 | 14 | |
| α-helix | 194-196 | 3 | |
| α-helix | 200-202 | 3 | |
| α-helix | 208-224 | 17 | |
| α-helix | 229-245 | 17 | |
| α-helix | 250-252 | 3 | |
| α-helix | 253-268 | 16 | |
| α-helix | 272-274 | 3 | |
| α-helix | 275-280 | 6 | |
| α-helix | 288-301 | 14 | |
| α-helix | 311-319 | 9 | |
| α-helix | 327-342 | 16 | |
| α-helix | 344-347 | 4 | |
| α-helix | 352-367 | 16 | |
| α-helix | 374-380 | 7 | |
| α-helix | 388-400 | 13 | |
| α-helix | 401-403 | 3 | |
| α-helix | 408-412 | 5 | |
| α-helix | 416-418 | 3 | |
| α-helix | 425-427 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cyclin-dependent kinase 2 | A, C | protein | 299 | Homo sapiens | P24941 (AlphaFold model) |
| Cyclin-A2 | B, D | protein | 258 | Homo sapiens | P20248 (AlphaFold model) |
>4EOI_1 Cyclin-dependent kinase 2 (chains A, C) SMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELN HPNIVKLLDVIHTENKLYLVFEFLHQDLKDFMDASALTGIPLPLIKSYLFQLLQGLAFCH SHRVLHRDLKPENLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKY YSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPS FPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>4EOI_2 Cyclin-A2 (chains B, D) VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHL AVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRM EHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSV IAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYK NSKYHGVSLLNPPETLNL
| ID | Name | Formula | Copies |
|---|---|---|---|
| SGM | Monothioglycerol | C3 H8 O2 S | 2 |
| 1RO | (5E)-5-(quinolin-6-ylmethylidene)-2-[(thiophen-2-ylmethyl)amino]-1,3-thiazol-4(… | C18 H13 N3 O S2 | 2 |
Water and common crystallization additives (DMS) are not listed.
An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity. Echalier, A., Cot, E., Camasses, A. et al. Chem Biol (2012) 19:1028-1040. DOI 10.1016/j.chembiol.2012.06.015 · PubMed
Other PDB entries of the same protein (UniProt P24941 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4EOI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.