X-ray structure of WDR5-MLL1 Win motif peptide binary complex. Determined by X-ray diffraction at 1.7 Å resolution. Released 30 May 2012.
Explore 4ESG in 3D Show helices and sheets RCSB PDB PDBe
4ESG contains 4 α-helices and 56 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-41 | 6 | 1 |
| β-strand | 48-53 | 6 | 2 |
| β-strand | 59-64 | 6 | 2 |
| β-strand | 69-73 | 5 | 2 |
| β-strand | 79-83 | 5 | 2 |
| β-strand | 90-95 | 6 | 3 |
| β-strand | 101-106 | 6 | 3 |
| β-strand | 110-115 | 6 | 3 |
| β-strand | 120-126 | 7 | 3 |
| β-strand | 132-137 | 6 | 4 |
| β-strand | 143-148 | 6 | 4 |
| β-strand | 153-157 | 5 | 4 |
| β-strand | 163-167 | 5 | 4 |
| β-strand | 174-179 | 6 | 5 |
| β-strand | 185-190 | 6 | 5 |
| β-strand | 195-199 | 5 | 5 |
| β-strand | 205-209 | 5 | 5 |
| α-helix | 215-216 | 2 | |
| β-strand | 217-222 | 6 | 6 |
| β-strand | 228-233 | 6 | 6 |
| β-strand | 237-242 | 6 | 6 |
| β-strand | 247-252 | 6 | 6 |
| β-strand | 264-267 | 4 | 7 |
| β-strand | 273-276 | 4 | 7 |
| β-strand | 283-287 | 5 | 7 |
| β-strand | 293-297 | 5 | 7 |
| β-strand | 304-309 | 6 | 1 |
| β-strand | 315-320 | 6 | 1 |
| β-strand | 327-331 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-41 | 6 | 8 |
| β-strand | 48-53 | 6 | 9 |
| β-strand | 59-64 | 6 | 9 |
| β-strand | 68-73 | 6 | 9 |
| β-strand | 79-84 | 6 | 9 |
| β-strand | 90-95 | 6 | 10 |
| β-strand | 101-106 | 6 | 10 |
| β-strand | 110-115 | 6 | 10 |
| β-strand | 120-126 | 7 | 10 |
| β-strand | 132-137 | 6 | 11 |
| β-strand | 143-148 | 6 | 11 |
| β-strand | 153-157 | 5 | 11 |
| β-strand | 163-167 | 5 | 11 |
| β-strand | 174-179 | 6 | 12 |
| β-strand | 185-190 | 6 | 12 |
| β-strand | 195-199 | 5 | 12 |
| β-strand | 205-209 | 5 | 12 |
| α-helix | 215-216 | 2 | |
| β-strand | 217-222 | 6 | 13 |
| β-strand | 228-233 | 6 | 13 |
| β-strand | 237-242 | 6 | 13 |
| β-strand | 247-252 | 6 | 13 |
| β-strand | 264-267 | 4 | 14 |
| β-strand | 273-276 | 4 | 14 |
| β-strand | 283-287 | 5 | 14 |
| β-strand | 293-297 | 5 | 14 |
| β-strand | 304-309 | 6 | 8 |
| β-strand | 315-320 | 6 | 8 |
| β-strand | 327-331 | 5 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3764-3766 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| WD repeat-containing protein 5 | A, B | protein | 312 | Homo sapiens | P61964 (AlphaFold model) |
| Histone-lysine N-methyltransferase MLL | C, D | protein | 17 | Homo sapiens | Q03164 |
>4ESG_1 WD repeat-containing protein 5 (chains A, B) ATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKT ISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSN LIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTAS GQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCI FANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALE NDKTIKLWKSDC
>4ESG_2 Histone-lysine N-methyltransferase MLL (chains C, D) EPPLNPHGSARAEVHLR
Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases. Dharmarajan, V., Lee, J.H., Patel, A. et al. J Biol Chem (2012) 287:27275-27289. DOI 10.1074/jbc.M112.364125 · PubMed
Other PDB entries of the same protein (UniProt P61964 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ESG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.