4EVT: Mouse Catenin beta-59 in 8.3M urea

Crystal Structure of Mouse Catenin beta-59 in 8.3M urea. Determined by X-ray diffraction at 2.34 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 2.34 Å
Organism: Mus musculus
Chains: 1
Atoms: 4,036
Mol. weight: 62.21 kDa
Ligands: URE
Released: 1 May 2013

Explore 4EVT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4EVT contains 38 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 38 helices, 0 β-strands

Element	Residues	Length
α-helix	170-180	11
α-helix	182-189	8
α-helix	195-204	10
α-helix	208-221	14
α-helix	225-233	9
α-helix	236-242	7
α-helix	243-245	3
α-helix	250-264	15
α-helix	269-275	7
α-helix	278-284	7
α-helix	285-287	3
α-helix	291-305	15
α-helix	309-317	9
α-helix	320-330	11
α-helix	334-348	15
α-helix	353-359	7
α-helix	362-367	6
α-helix	375-389	15
α-helix	399-408	10
α-helix	414-428	15
α-helix	432-440	9
α-helix	443-454	12
α-helix	458-471	14
α-helix	478-487	10
α-helix	491-496	6
α-helix	504-517	14
α-helix	521-523	3
α-helix	524-529	6
α-helix	532-548	17
α-helix	566-580	15
α-helix	584-592	9
α-helix	596-601	6
α-helix	602-604	3
α-helix	608-621	14
α-helix	625-633	9
α-helix	637-642	6
α-helix	643-645	3
α-helix	649-661	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin beta-1	A	protein	538	Mus musculus	Q02248 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4EVT_1 Catenin beta-1 (chains A)
HAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQ
MVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLF
YAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKL
IILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDP
SQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYK
NKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPV
VVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSM
GGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRV
AAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYK

Ligands and cofactors

ID	Name	Formula	Copies
URE	Urea	C H4 N2 O	56

Primary citation

Crystal Structure of Mouse Catenin beta-59 in 8.3M urea. Wang, C., Zhang, G.Y. To be published.

Other PDB entries of the same protein (UniProt Q02248 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DOW 1.8 Å, Crystal structure of a chimera of beta-catenin and alpha-catenin
4EV8 1.9 Å, Crystal structure of mouse catenin beta-59 in 2.4M urea.
1I7W 2.0 Å, Beta-catenin/phosphorylated E-cadherin complex
4EVA 2.0 Å, Crystal Structure of Mouse Catenin beta-59 in 5.6M urea
1M1E 2.1 Å, Beta-catenin armadillo repeat domain bound to ICAT
1V18 2.1 Å, The crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated…
3BCT 2.1 Å, The armadillo repeat region from murine beta-catenin
4EV9 2.1 Å, Crystal Structure of Mouse Catenin beta-59 in 4.0M urea
4EVP 2.25 Å, Crystal Structure of Mouse Catenin beta-59 in 7.2M urea
3OUX 2.4 Å, Structure of beta-catenin with phosphorylated Lef-1
4ONS 2.8 Å, Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin…
2BCT 2.9 Å, The armadillo repeat region from murine beta-catenin

Browse structure collections

About this viewer

MolViewer shows 4EVT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.