A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized protein STM14_2015 from Salmonella enterica. Determined by X-ray diffraction at 1.28 Å resolution. Released 8 Aug 2012.
Explore 4EXK in 3D Show helices and sheets RCSB PDB PDBe
4EXK contains 25 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-10 | 5 | 1 |
| α-helix | 17-31 | 15 | |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 43-50 | 8 | |
| β-strand | 59-63 | 5 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 67-72 | 6 | |
| β-strand | 76 | 1 | 2 |
| α-helix | 77-79 | 3 | |
| α-helix | 83-86 | 4 | |
| β-strand | 89 | 1 | 3 |
| α-helix | 91-96 | 6 | |
| β-strand | 98-99 | 2 | 4 |
| β-strand | 102-103 | 2 | 4 |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 128 | 1 | 6 |
| α-helix | 132-140 | 9 | |
| β-strand | 145-147 | 3 | 5 |
| α-helix | 154-163 | 10 | |
| β-strand | 167-172 | 6 | 7 |
| β-strand | 175-182 | 8 | 7 |
| α-helix | 186-200 | 15 | |
| α-helix | 210-218 | 9 | |
| β-strand | 222-227 | 6 | 5 |
| α-helix | 229-231 | 3 | |
| α-helix | 232-237 | 6 | |
| β-strand | 242-245 | 4 | 5 |
| α-helix | 246-248 | 3 | |
| β-strand | 249 | 1 | 6 |
| β-strand | 250 | 1 | 8 |
| β-strand | 253 | 1 | 8 |
| α-helix | 254-255 | 2 | |
| α-helix | 257 | 1 | |
| β-strand | 258-259 | 2 | 9 |
| β-strand | 260-266 | 7 | 1 |
| β-strand | 267 | 1 | 2 |
| α-helix | 273-278 | 6 | |
| α-helix | 279-284 | 6 | |
| α-helix | 287-296 | 10 | |
| β-strand | 301-302 | 2 | 1 |
| β-strand | 304 | 1 | 3 |
| α-helix | 305-311 | 7 | |
| α-helix | 315-326 | 12 | |
| β-strand | 328-329 | 2 | 9 |
| α-helix | 330-331 | 2 | |
| α-helix | 336-351 | 16 | |
| α-helix | 357-369 | 13 | |
| α-helix | 370-373 | 4 | |
| β-strand | 379-382 | 4 | 10 |
| β-strand | 386-387 | 2 | 11 |
| β-strand | 392-398 | 7 | 10 |
| β-strand | 400 | 1 | 12 |
| β-strand | 406 | 1 | 12 |
| β-strand | 412-418 | 7 | 11 |
| β-strand | 424-427 | 4 | 10 |
| β-strand | 431-432 | 2 | 10 |
| β-strand | 438-447 | 10 | 10 |
| β-strand | 451-459 | 9 | 11 |
| β-strand | 463-471 | 9 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Maltose-binding periplasmic protein, uncharacterized protein chimera | A | protein | 487 | Escherichia coli, Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S | A0A0F6B1U8 (AlphaFold model), P0AEX9 (AlphaFold model) |
>4EXK_1 Maltose-binding periplasmic protein, uncharacterized protein chimera (chains A) SNAAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDG PDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLI YNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKY DIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNID TSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKD KPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQT VDAALAAAQTNAAANTPSPDLTVMSIDKSVLSPGESATITTIVKDIDGNPVNEVHINKTV ARENLKGLWDYGPLKKENVPGKYTQVITYRGHSNERIDISFKYAMSFTKEISIRGRLSLS SVKNNIG
A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized protein STM14_2015 form Salmonella enterica. Nocek, B., Hatzos-Skintges, C., Jedrzejczak, R. et al. To be published.
MolViewer shows 4EXK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.