Crystal structures reveal the multi-ligand binding mechanism of the Staphylococcus aureus ClfB. Determined by X-ray diffraction at 2.5 Å resolution. Released 8 Aug 2012.
Explore 4F20 in 3D Show helices and sheets RCSB PDB PDBe
4F20 contains 7 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 214 | 1 | 1 |
| α-helix | 216-218 | 3 | |
| β-strand | 219-226 | 8 | 1 |
| β-strand | 230-231 | 2 | 2 |
| β-strand | 235 | 1 | 3 |
| β-strand | 239-247 | 9 | 1 |
| β-strand | 253 | 1 | 4 |
| β-strand | 255 | 1 | 4 |
| β-strand | 256-260 | 5 | 1 |
| β-strand | 265-266 | 2 | 5 |
| β-strand | 269 | 1 | 3 |
| β-strand | 271 | 1 | 6 |
| α-helix | 274-276 | 3 | |
| β-strand | 279-286 | 8 | 1 |
| β-strand | 292-299 | 8 | 1 |
| β-strand | 304-309 | 6 | 1 |
| α-helix | 311-313 | 3 | |
| β-strand | 320-327 | 8 | 1 |
| β-strand | 328-329 | 2 | 5 |
| β-strand | 338-341 | 4 | 2 |
| β-strand | 344-346 | 3 | 1 |
| β-strand | 350-351 | 2 | 1 |
| β-strand | 354-357 | 4 | 2 |
| β-strand | 374-381 | 8 | 6 |
| β-strand | 389-396 | 8 | 6 |
| β-strand | 403-411 | 9 | 3 |
| α-helix | 417-419 | 3 | |
| β-strand | 422-423 | 2 | 6 |
| β-strand | 430-436 | 7 | 6 |
| α-helix | 439-441 | 3 | |
| β-strand | 455-457 | 3 | 6 |
| α-helix | 459-461 | 3 | |
| α-helix | 463-465 | 3 | |
| β-strand | 466-467 | 2 | 3 |
| β-strand | 473-481 | 9 | 3 |
| β-strand | 485-493 | 9 | 6 |
| β-strand | 501-509 | 9 | 3 |
| β-strand | 518-529 | 12 | 3 |
| β-strand | 532-536 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 319-324 | 6 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Clumping factor B | A | protein | 363 | Staphylococcus aureus | Q6GDH2 (AlphaFold model) |
| peptide from Dermokine | Q | protein | 13 | Homo sapiens | Q6E0U4 (AlphaFold model) |
>4F20_1 Clumping factor B (chains A) MRGSHHHHHHENLYFQGSLAVAEPVVNAADAKGTNVNDKVTASDFKLEKTAFDPNQSGNT FMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYD ILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNY SSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEE SSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFG DINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDS AVN
>4F20_2 peptide from Dermokine (chains Q) GQSGSSGSGSNGD
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB. Xiang, H., Feng, Y., Wang, J.W. et al. PLoS Pathog (2012) 8:e1002751-e1002751. DOI 10.1371/journal.ppat.1002751 · PubMed
Other PDB entries of the same protein (UniProt Q6GDH2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4F20 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.