4F7U: The 6S snRNP assembly intermediate
The 6S snRNP assembly intermediate. Determined by X-ray diffraction at 1.9 Å resolution. Released 30 Jan 2013.
- Method
- X-ray diffraction
- Resolution
- 1.9 Å
- Organisms
- Mus musculus, Xenopus laevis, Drosophila melanogaster
- Chains
- 12
- Atoms
- 8,525
- Mol. weight
- 141.45 kDa
- Released
- 30 Jan 2013
Explore 4F7U in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4F7U contains 33 α-helices and 68 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1004-1007 | 4 | |
| β-strand | 1014-1019 | 6 | 1 |
| β-strand | 1024-1032 | 9 | 1 |
| β-strand | 1038-1046 | 9 | 1 |
| β-strand | 1053-1060 | 8 | 1 |
| α-helix | 1062-1064 | 3 | |
| β-strand | 1065-1069 | 5 | 1 |
| α-helix | 1070-1071 | 2 | |
| α-helix | 1076-1079 | 4 | |
Chain B: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2023-2026 | 4 | |
| α-helix | 2030-2037 | 8 | |
| β-strand | 2041-2046 | 6 | 1 |
| α-helix | 2047-2049 | 3 | |
| β-strand | 2051-2059 | 9 | 1 |
| β-strand | 2065-2075 | 11 | 1 |
| β-strand | 2091-2101 | 11 | 1 |
| α-helix | 2103-2105 | 3 | |
| β-strand | 2106-2110 | 5 | 1 |
Chain C: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1003-1007 | 5 | |
| β-strand | 1014-1019 | 6 | 2 |
| β-strand | 1024-1032 | 9 | 2 |
| β-strand | 1038-1046 | 9 | 2 |
| β-strand | 1053-1060 | 8 | 2 |
| α-helix | 1062-1064 | 3 | |
| β-strand | 1065-1069 | 5 | 2 |
| α-helix | 1076-1079 | 4 | |
Chain D: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2017-2026 | 10 | |
| α-helix | 2030-2038 | 9 | |
| β-strand | 2041-2046 | 6 | 2 |
| α-helix | 2047-2049 | 3 | |
| β-strand | 2050-2059 | 10 | 2 |
| β-strand | 2065-2075 | 11 | 2 |
| β-strand | 2091-2101 | 11 | 2 |
| α-helix | 2103-2105 | 3 | |
| β-strand | 2106-2111 | 6 | 2 |
Chains E and H: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3017-3027 | 11 | |
| β-strand | 3030-3035 | 6 | 1 |
| β-strand | 3041-3050 | 10 | 1 |
| β-strand | 3056-3065 | 10 | 1 |
| β-strand | 3070-3079 | 10 | 1 |
| α-helix | 3081-3083 | 3 | |
| β-strand | 3084-3089 | 6 | 1 |
Chain F: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4007-4014 | 8 | |
| β-strand | 4018-4023 | 6 | 1 |
| β-strand | 4028-4036 | 9 | 1 |
| β-strand | 4042-4051 | 10 | 1 |
| β-strand | 4054-4064 | 11 | 1 |
| α-helix | 4066-4068 | 3 | |
| β-strand | 4069-4074 | 6 | 1 |
Chain G: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5008-5012 | 5 | |
| β-strand | 5016-5021 | 6 | 1 |
| α-helix | 5022-5024 | 3 | |
| β-strand | 5025-5034 | 10 | 1 |
| β-strand | 5040-5048 | 9 | 1 |
| β-strand | 5054-5062 | 9 | 1 |
| α-helix | 5064-5066 | 3 | |
| β-strand | 5067-5072 | 6 | 1 |
Chain I: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4007-4013 | 7 | |
| β-strand | 4018-4023 | 6 | 2 |
| β-strand | 4028-4036 | 9 | 2 |
| β-strand | 4042-4051 | 10 | 2 |
| β-strand | 4054-4064 | 11 | 2 |
| α-helix | 4066-4068 | 3 | |
| β-strand | 4069-4074 | 6 | 2 |
3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Small nuclear ribonucleoprotein Sm D1 | A, C | protein | 119 | Mus musculus | P62315 (AlphaFold model) |
| Small nuclear ribonucleoprotein Sm D2 | B, D | protein | 118 | Mus musculus | P62317 (AlphaFold model) |
| Small nuclear ribonucleoprotein E | E, H | protein | 92 | Mus musculus | P62305 (AlphaFold model) |
| Small nuclear ribonucleoprotein F | F, I | protein | 86 | Xenopus laevis | P62321 (AlphaFold model) |
| Small nuclear ribonucleoprotein G | G, J | protein | 76 | Mus musculus | P62309 |
| Methylosome subunit pICln | P, Q | protein | 129 | Drosophila melanogaster | A1ZAW5 |
Sequence of entity 1 (A, C), FASTA
>4F7U_1 Small nuclear ribonucleoprotein Sm D1 (chains A, C)
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
Sequence of entity 2 (B, D), FASTA
>4F7U_2 Small nuclear ribonucleoprotein Sm D2 (chains B, D)
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
Sequence of entity 3 (E, H), FASTA
>4F7U_3 Small nuclear ribonucleoprotein E (chains E, H)
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
Sequence of entity 4 (F, I), FASTA
>4F7U_4 Small nuclear ribonucleoprotein F (chains F, I)
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
Sequence of entity 5 (G, J), FASTA
>4F7U_5 Small nuclear ribonucleoprotein G (chains G, J)
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV
Sequence of entity 6 (P, Q), FASTA
>4F7U_6 Methylosome subunit pICln (chains P, Q)
MVLIMHVSPPEHGLLYTANNIKLKLGDKVVGEGTVYIAQNTLSWQPTELAEGISIEWKQV
SLHGISSNPRKCIYFMLDHKVEWNGVYGDVDEQFGEVTECWLMPEDIATVDTMYSAMTTC
QALHHHHHH
Primary citation
Structural Basis of Assembly Chaperone- Mediated snRNP Formation. Grimm, C., Chari, A., Pelz, J.P. et al. Mol Cell (2013) 49:692-703. DOI 10.1016/j.molcel.2012.12.009 · PubMed
Browse structure collections
About this viewer
MolViewer shows 4F7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.