4F8C: Cycle Inhibiting Factor

Structure of the Cif:Nedd8 complex - Yersinia pseudotuberculosis Cycle Inhibiting Factor in complex with human Nedd8. Determined by X-ray diffraction at 1.95 Å resolution. Released 20 Jun 2012.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Yersinia pseudotuberculosis, Homo sapiens
Chains: 4
Atoms: 5,747
Mol. weight: 81.96 kDa
Released: 20 Jun 2012

Explore 4F8C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F8C contains 39 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	41-53	13
α-helix	57-63	7
α-helix	72-74	3
α-helix	77-95	19
α-helix	99-106	8
β-strand	115	1	1
α-helix	117-129	13
β-strand	131	1	2
β-strand	134	1	2
α-helix	142-143	2
β-strand	144	1	3
α-helix	146-153	8
β-strand	161-168	8	3
β-strand	173-179	7	3
β-strand	188-189	2	4
β-strand	190-192	3	3
β-strand	195	1	5
β-strand	204	1	5
α-helix	206-212	7
β-strand	218-219	2	4
α-helix	220-229	10
α-helix	237-244	8
α-helix	250-252	3
α-helix	255-257	3
α-helix	260-262	3
β-strand	266-273	8	3
α-helix	275-285	11

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	6
β-strand	12-16	5	6
β-strand	22	1	7
α-helix	23-34	12
α-helix	38-40	3
β-strand	42-45	4	6
β-strand	48-49	2	6
β-strand	55	1	7
α-helix	56-59	4
β-strand	66-70	5	6
β-strand	72	1	1

Chain C: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	41-53	13
α-helix	57-63	7
α-helix	72-74	3
α-helix	77-95	19
α-helix	99-106	8
β-strand	115	1	8
α-helix	117-129	13
α-helix	138-140	3
α-helix	142-145	4
α-helix	146-155	10
β-strand	161-168	8	9
β-strand	173-179	7	9
β-strand	189	1	10
β-strand	190-192	3	9
β-strand	195	1	11
α-helix	202-203	2
β-strand	204	1	11
α-helix	206-212	7
β-strand	218	1	10
α-helix	220-231	12
α-helix	237-244	8
α-helix	250-252	3
α-helix	255-257	3
α-helix	260-262	3
β-strand	266-273	8	9
α-helix	275-285	11

Chain D: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	12
β-strand	12-16	5	12
β-strand	22	1	13
α-helix	23-34	12
α-helix	38-40	3
β-strand	42-45	4	12
β-strand	48-49	2	12
α-helix	50-51	2
β-strand	55	1	13
α-helix	57-59	3
β-strand	66-70	5	12
β-strand	72	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cycle Inhibiting Factor	A, C	protein	275	Yersinia pseudotuberculosis	A0A0H3B1Q8 (AlphaFold model)
NEDD8	B, D	protein	88	Homo sapiens	Q15843 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4F8C_1 Cycle Inhibiting Factor (chains A, C)
MAHHHHHHSSGLEVLFQGPPVSHSINNPSIQHVQDFATLSARSLRANVLLNSDDHSVPIH
AKNPSELLEAIDNNISQTAQDWGVSIQEVEVILGSSKRIIEPVAGVTANTIMKLFLDNDI
FSYSFEKGQSLSLSQLQERLASLPAHKNFILRVNDGGLGHAYVIDFPATTNPSRDAFLYQ
SDLGEGVTREVRFEDWMTQKASHPISLDDINTHFIGIAQDQIDLAHIAKLFDVDGNVKML
RADHLISHKTSEFNFQLFEYDLKNLENNMSIIKTH

Sequence of entity 2 (B, D), FASTA

>4F8C_2 NEDD8 (chains B, D)
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQKHHHHHH

Primary citation

The molecular basis of Nedd8 deamidation by the bacterial effector protein Cif. Crow, A., Hughes, R.K., Taieb, F. et al. Proc Natl Acad Sci U S A (2012).

Browse structure collections

About this viewer

MolViewer shows 4F8C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.