4F8Q: Human BTN3A2 Ectodomain

Crystal Structure of the Human BTN3A2 Ectodomain. Determined by X-ray diffraction at 2.38 Å resolution. Released 8 Aug 2012.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,646
Mol. weight: 23.64 kDa
Released: 8 Aug 2012

Explore 4F8Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4F8Q contains 8 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	11-14	4	2
β-strand	19-26	8	1
β-strand	35-40	6	2
β-strand	45-51	7	2
β-strand	54-55	2	2
α-helix	57-59	3
α-helix	62-64	3
β-strand	68-71	4	1
α-helix	75-77	3
β-strand	79-84	6	1
α-helix	89-91	3
β-strand	93-101	9	2
β-strand	104-115	12	2
β-strand	116	1	3
α-helix	119-121	3
β-strand	122-129	8	4
β-strand	132-142	11	4
β-strand	143	1	3
α-helix	145-146	2
β-strand	147-151	5	5
β-strand	158	1	5
β-strand	161-162	2	4
α-helix	163-165	3
β-strand	166-167	2	4
β-strand	173-181	9	4
β-strand	188-195	8	5
β-strand	200-207	8	5
α-helix	210-213	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A2	A	protein	219	Homo sapiens	P78410 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4F8Q_1 Butyrophilin subfamily 3 member A2 (chains A)
ADLQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVE
DRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAAL
GSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAA
SVIMRGGSGEGVSCIIRNSLLGLEKTASISIADHHHHHH

Primary citation

The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies. Palakodeti, A., Sandstrom, A., Sundaresan, L. et al. J Biol Chem (2012) 287:32780-32790. DOI 10.1074/jbc.M112.384354 · PubMed

Other PDB entries of the same protein (UniProt P78410 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZHR 3.0 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A2 complex
9JQR 3.0 Å, Cryo-EM structure of the Vgamma9Vdelta2 TCR-engaged BTN3A1-BTN3A2-BTN2A1 complex
9IRD 3.2 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A2 mutant (BTN3A1 H381R, BTN2A1 R477A/T510A) in…
9JQQ 3.26 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 complex
9JQP 3.34 Å, Cryo-EM structure of the HMBPP-primed BTN3A1-BTN3A2-BTN2A1 in complex with agonist…
8ZJX 3.35 Å, Cryo-EM structure of the full length pAg-bound BTN2A1-BTN3A1-BTN3A2 in complex with…
8ZK0 3.4 Å, Cryo-EM structure of the full length pAg-bound BTN2A1-BTN3A1-BTN3A2 in complex with…
9L1P 3.5 Å, Cryo-EM structure of the ICT01-BTN2A1/BTN3A1/BTN3A2 complex, local refinement
9KWE 3.7 Å, Cryo-EM structure of the ICT01-BTN3A1/BTN3A2 complex
9KWZ 3.7 Å, Cryo-EM structure of the ICT01-BTN2A1/BTN3A1/BTN3A2 complex
9L1O 3.7 Å, Cryo-EM structure of the ICT01-BTN3A1/BTN3A2 complex, local refinement
8ZK1 3.8 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A2 mutant complex (BTN3A1 H381R, BTN2A1…

Browse structure collections

About this viewer

MolViewer shows 4F8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.